Skip to Content
Merck
All Photos(3)

Key Documents

HPA010134

Sigma-Aldrich

Anti-PNKD antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-myofibrillogenesis regulator 1 isoform 1 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

GATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKNPMKA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PNKD(25953)

Looking for similar products? Visit Product Comparison Guide

General description

PNKD (paroxysmal nonkinesigenic dyskinesia) gene is localized to human chromosome 2q35. It was first obtained from the cDNA library of human skeletal muscle, using PCR (polymerase chain reaction) and rapid amplification of cDNA ends. This gene is composed of three exons, which code for a protein of 142 amino acids, containing a transmembrane hydrophobic region. It is highly expressed in skeletal muscle and myocardium.

Immunogen

myofibrillogenesis regulator 1 isoform 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

PNKD (paroxysmal nonkinesigenic dyskinesia), when up-regulated, is capable of promoting cancer proliferation and migration in human hepatoma G2 (HepG2) cells. This might be an outcome of its interaction with the eukaryotic initiation factor 3, which controls tumor growth and invasiveness. Its overexpression also results in the activation of nuclear factor κB signaling pathway, which is linked with cancer, autoimmune diseases and inflammation. It is a marker to determine the prognosis, outcome and therapy in GC (gastric cancer) patients. Mutation in this gene results in the autosomal dominant disorder PNKD, which is characterized by spontaneous or alcohol, coffee, tea, stree-mediated attacks and unilateral or bilateral involuntary movements. In human breast cancer MCF7 cell line, it activates ERK1/2 (extracellular signal-regulated kinase) signaling pathway, thus, functioning as a tumor promoter. In pancreatic ductal adenocarcinoma (PDAC), it is linked with aggressiveness and poor prognosis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71927

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jing Guo et al.
World journal of gastroenterology, 18(38), 5434-5441 (2012-10-20)
To investigate the expression of myofibrillogenesis regulator-1 (MR-1) in relation to clinicopathological parameters and postoperative survival in a group of Chinese patients with gastric cancer. In our previous study of human whole-genome gene expression profiling, the differentially expressed genes were
Chang-Yong Zhao et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 34(5), 2983-2987 (2013-05-23)
Myofibrillogenesis regulator-1 (MR-1) expression was detected in different malignancies and is associated with poor prognosis. However, its role in pancreatic ductal adenocarcinoma (PDAC) has not been fully elucidated. Thus, the aim of this study was to investigate the association of
Yuyan Gong et al.
FEBS letters, 588(17), 2903-2910 (2014-07-30)
Myofibrillogenesis regulator-1 (MR-1) has been characterized as a tumor promoter in many cancers. However, its mechanism of action has not been fully elucidated. Here, we report that MR-1 is overexpressed in human breast cancer cells and participates in tumor promotion
Wenxia Zhao et al.
Advanced science (Weinheim, Baden-Wurttemberg, Germany), 11(15), e2306472-e2306472 (2024-02-12)
Myofibrillogenesis regulator-1 (MR-1) is a multifunctional protein involved in the development of various human tumors. The study is the first to report the promoting effect of MR-1 on the development and metastasis of non-small cell lung cancer (NSCLC). MR-1 is
Margaret P Adam et al.
GeneReviews(?), 2005 Jun 24 (Updated 2011 May 03) (2011-05-03)
Familial paroxysmal nonkinesigenic dyskinesia (referred to as familial PNKD in this entry) is characterized by unilateral or bilateral involuntary movements; attacks are spontaneous or precipitated by alcohol, coffee or tea, chocolate, excitement, stress, or fatigue. Attacks involve dystonic posturing with

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service