Skip to Content
Merck
All Photos(2)

Key Documents

AV47723

Sigma-Aldrich

Anti-TBX15 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-T-box 15, Anti-TBX14

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

55 kDa

species reactivity

rabbit, rat, human, bovine, horse, mouse, dog, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TBX15(6913)

General description

TBX15 codes for T-box transcription factor that regulates embryonic development. TBX15 mutations have been linked to Cousin syndrome.
Rabbit anti-TBX15 antibody recognizes human, mouse, rat, and canine TBX15.

The previously assigned protein identifier Q5JT54 has been merged into Q96SF7. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the C terminal region of human TBX15

Application

Rabbit anti-TBX15 antibody is suitable for western blot applications at a concentration of 1.25μg/ml and for IHC applications (using paraffin-embedded tissues) at 4-8μg/ml.

Biochem/physiol Actions

TBX15 is a probable transcriptional regulator involved in developmental processes.

Sequence

Synthetic peptide located within the following region: YGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Esra Dikoglu et al.
American journal of medical genetics. Part A, 161A(12), 3161-3165 (2013-09-17)
Cousin syndrome, also called pelviscapular dysplasia (OMIM 260660), is characterized by short stature, craniofacial dysmorphism, and multiple skeletal anomalies. Following its description in two sibs in 1982, no new cases have been observed until the observation of two unrelated cases
Ekkehart Lausch et al.
American journal of human genetics, 83(5), 649-655 (2008-12-11)
Members of the evolutionarily conserved T-box family of transcription factors are important players in developmental processes that include mesoderm formation and patterning and organogenesis both in vertebrates and invertebrates. The importance of T-box genes for human development is illustrated by

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service