Skip to Content
Merck
All Photos(2)

Key Documents

SAB1404141

Sigma-Aldrich

Monoclonal Anti-NOVA1, (C-terminal) antibody produced in mouse

clone 5D9, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Nova-1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

5D9, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37.11 kDa

species reactivity

rat, human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NOVA1(4857)

General description

This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. (provided by RefSeq)

Immunogen

NOVA1 (NP_002506, 408 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG

Application

Monoclonal Anti-NOVA1, (C-terminal) antibody produced in mouse is suitable for indirect ELISA and western blot analysis.

Biochem/physiol Actions

NOVA1 is associated with several post-transcriptional regulation of RNA metabolism including RNA splicing, editing to transport, localization, and degradation. It may be involved in mediating neuronal responsiveness. It encodes a protein which has homology with the RNA-binding protein hnRNP K, the yeast splicing protein MER1. Since, it has some homology with hnRNP K, it may influence the regulation of RNA splicing or metabolism in developing neurons. The importance of NOVA1 as prognostic marker has been reported in HCC (Hepatocellular carcinoma). Alteration in gene causes a disorder associated with breast cancer and motor dysfunction i.e. paraneoplastic opsoclonus myoclonus ataxia (POMA).

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

R J Buckanovich et al.
Neuron, 11(4), 657-672 (1993-10-01)
Paraneoplastic opsoclonus-ataxia, a disorder of motor control, develops in breast or lung cancer patients who harbor an antibody (Ri) that recognizes their tumors and a nuclear neuronal protein of 55 kd. We have characterized a gene, Nova, encoding an antigen
R J Buckanovich et al.
Molecular and cellular biology, 17(6), 3194-3201 (1997-06-01)
Nova-1, an autoantigen in paraneoplastic opsoclonus myoclonus ataxia (POMA), a disorder associated with breast cancer and motor dysfunction, is a neuron-specific nuclear RNA binding protein. We have identified in vivo Nova-1 RNA ligands by combining affinity-elution-based RNA selection with protein-RNA
Yi-An Zhang et al.
PloS one, 9(3), e90955-e90955 (2014-03-13)
Neuro-oncological ventral antigen 1 (Nova1) is a neuron-specific RNA-binding protein in human paraneoplastic opsoclonus-myoclonus ataxia accompanying with malignant tumors, but its role in hepatocellular carcinoma (HCC) remains elusive. In this study, we found that overexpressed intratumoral Nova1 was associated with
Hualing Li et al.
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, 61(1), 45-54 (2012-10-09)
The present study aimed to evaluate the expression of neuro-oncological ventral antigen 1 (Nova1) in cerebral ischemia/reperfusion (I/R) insults by immunohistochemistry. The focal cerebral I/R model was induced by right middle cerebral artery occlusion (MCAO) for 120 min followed by

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service