SAB1401753
Anti-H2AFY2 antibody produced in rabbit
purified immunoglobulin, buffered aqueous solution
Synonym(s):
macroH2A2
About This Item
Recommended Products
Related Categories
1 of 4
This Item | HPA041189 | HPA057236 | HPA041943 |
---|---|---|---|
unconjugated | unconjugated | unconjugated | unconjugated |
purified immunoglobulin | affinity isolated antibody | affinity isolated antibody | affinity isolated antibody |
buffered aqueous solution | buffered aqueous glycerol solution | buffered aqueous glycerol solution | buffered aqueous glycerol solution |
dry ice | wet ice | wet ice | wet ice |
polyclonal | polyclonal | polyclonal | polyclonal |
Immunogen
Sequence
MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
Physical form
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Need A Sample COA?
This is a sample Certificate of Analysis (COA) and may not represent a recently manufactured lot of this specific product.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service