Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

WH0003569M1

Sigma-Aldrich

Monoclonal Anti-IL6 antibody produced in mouse

clone 3E4, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-BSF2, Anti-HGF, Anti-HSF, Anti-IFNB2, Anti-IL6, Anti-interleukin 6 (interferon, beta 2)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3E4, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2bκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IL6(3569)

Catégories apparentées

Description générale

Interleukin-6 (IL-6) is a proinflammatory cytokine. The gene encoding it has five exons and is located on human chromosome 7. Human IL-6 is a 21–26 kDa glycoprotein. It has 212 amino acids along with a 28-amino-acid-signal peptide.
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. (provided by RefSeq)

Immunogène

IL6 (NP_000591, 29 a.a. ~ 212 a.a) recombinant protein.

Sequence
SPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Actions biochimiques/physiologiques

Interleukin-6 (IL-6) plays a vital role in intracellular signaling pathways. The protein is linked with cancerous cell metastasis and growth. IL-6 serves as a modulator of estrogen synthesis and aromatase activity. IL-6 stimulates immunoglobulin synthesis.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

IL-6 in Inflammation, Immunity, and Disease
Tanaka T, et al.
Cold Spring Harbor Perspectives in Biology (2014)
IL-6 variant is associated with metastasis in breast cancer patients
Abana CO, et al.
PLoS ONE, 12(7) (2017)
Targeting interlukin-6 to relieve immunosuppression in tumor microenvironment
Liu Q, et al.
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine, 39(6) (2017)
Interleukin 6
Kishimoto T and Tanaka T
Encyclopedia of Inflammatory Diseases, 1-8 (2014)
Meta-analysis of the role of IL-6 rs1800795 polymorphism in the susceptibility to prostate cancer: Evidence based on 17 studies
Liu TZ, et al.
Medicine, 96(11) (2017)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique