Accéder au contenu
Merck
Toutes les photos(6)

Principaux documents

SAB2108266

Sigma-Aldrich

Anti-GAPDH Antibody

rabbit polyclonal

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

product name

Anti-GAPDH antibody produced in rabbit, affinity isolated antibody

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

36kDa

Espèces réactives

guinea pig, rat, horse, human, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunoblotting: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... GAPDH(2597)

Description générale

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) localizes in the cytoplasm but can be translocated to the nucleus depending on cellular conditions. It is a tetramer containing identical chains. The gene encoding this protein is localized on human chromosome 12p13.

Immunogène

Synthetic peptide directed towards the middle region of human GAPDH

Application

Anti-GAPDH antibody produced in rabbit has been used in western blotting.

Actions biochimiques/physiologiques

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) catalyzes the reversible oxidative phosphorylation of glyceraldehyde-phosphate, which is a critical energy-yielding step in carbohydrate metabolism. It binds to several proteins including actin, tubulin, amyloid precursor, polyglutamine peptides, DRPLA (dentatorubral-pallidoluysian atrophy) and huntingtin. Phosphorylated GAPDH associates with cytoskeletal elements and controls microtubule dynamics in the early secretory pathway. GAPDH is also a component of the functional GAIT (interferon-γ-activated inhibitor of translation) mRNP (messenger ribonucleoprotein). GAPDH expression is dysregulated during melanoma progression.

Séquence

Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

RAR?2-dependent signaling represses neuronal differentiation in mouse ES cells.
Kona SL, et al.
Differentiation, 98, 55-61 (2017)
Oxidized low-density lipoprotein decreases VEGFR2 expression in HUVECs and impairs angiogenesis.
Zhang M and Jiang L
Experimental and Therapeutic Medicine, 12, 3742-3748 (2016)
Xin Zhao et al.
Journal of cellular and molecular medicine, 25(1), 484-498 (2020-11-19)
Glucocorticoid (GC)-induced osteonecrosis of the femoral head (GC-ONFH) is considered as one of the most serious side effects of long-term or over-dose steroid therapy. However, the underlying cause mechanisms are still not fully investigated. We firstly established a rat model
Mutant huntingtin: nuclear translocation and cytotoxicity mediated by GAPDH.
Bae BI, et al.
Proceedings of the National Academy of Sciences of the USA, 103, 3405-3409 (2006)
Glyceraldehyde-3-phosphate dehydrogenase is phosphorylated by protein kinase Ciota /lambda and plays a role in microtubule dynamics in the early secretory pathway.
Tisdale EJ
The Journal of Biological Chemistry, 277, 3334-3341 (2002)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique