Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

SAB1402978

Sigma-Aldrich

Monoclonal Anti-MLL2 antibody produced in mouse

clone 2E1, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

AAD10, ALR, CAGL114, MLL4, TNRC21, Anti-AAD10, Anti-ALL1-related protein, Anti-ALR, Anti-CAGL114, Anti-Histone-lysine N-methyltransferase, Anti-KMS, Anti-KMT2B, Anti-KMT2D, Anti-Kabuki make-up syndrome, Anti-Kabuki mental retardation syndrome, Anti-MLL4, Anti-Myeloid/lymphoid or mixed-lineage leukemia 2, Anti-TNRC21

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2E1, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~37.11 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MLL2(8085)

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Description générale

Mixed-lineage leukemia 2 (MLL2), a histone methyltransferase that belongs to the trithorax group, is expressed ubiquitously in adult tissues. Structurally, MLL2 comprises plant homeodomain (PHD), Su(var)3-9, Enhancer-of-zeste and Trithorax (SET) domain, and a high mobility group (HMG) box. The MLL2 gene is mapped to human chromosome 12q13.12.

Immunogène

MLL2 (NP_003473.1, 1487 a.a. ~ 1586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE

Actions biochimiques/physiologiques

Mixed-lineage leukemia 2 (MLL2) regulates the expression of homeobox (Hox) genes. Mutations or haploinsufficiency in the MML2 gene is implicated in Kabuki syndrome, a multi-systemic disorder. It carries out methylation on the lysine 4 of histone H3 (H3K4). MLL2 plays a tumor suppressor role in Merkel cell carcinoma.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Reety Arora et al.
Viruses, 12(9) (2020-09-04)
Merkel cell carcinoma (MCC) is an uncommon, lethal cancer of the skin caused by either Merkel cell polyomavirus (MCPyV) or UV-linked mutations. MCPyV is found integrated into MCC tumor genomes, accompanied by truncation mutations that render the MCPyV large T
Alessandra Fasciani et al.
Nature genetics, 52(12), 1397-1411 (2020-11-11)
The genetic elements required to tune gene expression are partitioned in active and repressive nuclear condensates. Chromatin compartments include transcriptional clusters whose dynamic establishment and functioning depend on multivalent interactions occurring among transcription factors, cofactors and basal transcriptional machinery. However
N Bögershausen et al.
Clinical genetics, 83(3), 212-214 (2012-11-08)
To unravel the system of epigenetic control of transcriptional regulation is a fascinating and important scientific pursuit. Surprisingly, recent successes in gene identification using high-throughput sequencing strategies showed that, despite their ubiquitous role in transcriptional control, dysfunction of chromatin-modifying enzymes
Young-Wook Cho et al.
The Journal of biological chemistry, 282(28), 20395-20406 (2007-05-15)
PTIP, a protein with tandem BRCT domains, has been implicated in DNA damage response. However, its normal cellular functions remain unclear. Here we show that while ectopically expressed PTIP is capable of interacting with DNA damage response proteins including 53BP1

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique