Accéder au contenu
Merck
Toutes les photos(9)

Principaux documents

HPA021367

Sigma-Aldrich

Anti-IGF2BP1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-CRD-BP, Anti-Coding region determinant-binding protein, Anti-IGF-II mRNA-binding protein 1, Anti-IGF2 mRNA-binding protein 1, Anti-IMP-1, Anti-Insulin-like growth factor 2 mRNA-binding protein 1, Anti-VICKZ family member 1, Anti-ZBP-1, Anti-Zip code-binding protein 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

Séquence immunogène

DVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKK

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IGF2BP1(10642)

Description générale

The gene IGF2BP1 (insulin-like growth factor 2 mRNA-binding protein 1) is mapped to human chromosome 17q21. It belongs to the IGF (insulin-like growth factor)-II mRNA-binding proteins family. The protein contains RNA recognition motifs and K-homology domains. IGF2BP1 localizes mainly in the cytoplasm and subcytoplasmic domains. IGF2BP1 is also referred to as IMP1 (insulin-like growth factor 2 mRNA-binding protein 1) or CRD-BP (coding region determinant-binding protein).

Immunogène

Insulin-like growth factor 2 mRNA-binding protein 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-IGF2BP1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

IGF2BP1 (insulin-like growth factor 2 mRNA-binding protein 1) is important for the mRNA localization, turnover and translational control. It binds to the target mRNAs and thereby regulates its cytoplasmic fate. For instance, it binds to the 3′-untranslated region of CD44 mRNA and stabilizes it. Similarly, it interacts with the coding region of βTrCP1 (F-box and WD repeats protein) mRNA and stabilizes it. IGF2BP1 is up-regulated in non-small cell lung cancers and is associated with tumor progression. It is also up-regulated in neuroblastoma.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST75731

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Aiting Yan et al.
Oncology letters, 20(6), 359-359 (2020-11-03)
Esophageal cancer (ESCA) is the eighth most common cause of cancer-associated mortality in humans. An increasing number of studies have demonstrated that microRNAs (miRs) serve important roles in mediating tumor initiation and progression. miR-454-3p has been found to be involved
Mark Barnes et al.
The Journal of biological chemistry, 290(1), 625-639 (2014-11-13)
The ability of its four heterogeneous nuclear RNP-K-homology (KH) domains to physically associate with oncogenic mRNAs is a major criterion for the function of the coding region determinant-binding protein (CRD-BP). However, the particular RNA-binding role of each of the KH
J Nielsen et al.
Molecular and cellular biology, 19(2), 1262-1270 (1999-01-16)
Insulin-like growth factor II (IGF-II) is a major fetal growth factor. The IGF-II gene generates multiple mRNAs with different 5' untranslated regions (5' UTRs) that are translated in a differential manner during development. We have identified a human family of
Jessica L Bell et al.
Journal of clinical oncology : official journal of the American Society of Clinical Oncology, 33(11), 1285-1293 (2015-03-11)
Chromosomal 17q21-ter gain in neuroblastoma is both a common and prognostically significant event. The insulin-like growth factor-2 mRNA-binding protein 1 (IGF2BP1) gene is located near the proximal edge of this region. Here, its prognostic value is evaluated in neuroblastoma. The
Jacob Nielsen et al.
The Biochemical journal, 376(Pt 2), 383-391 (2003-08-19)
The human IMPs (insulin-like growth factor II mRNA-binding proteins) belong to a vertebrate zipcode-binding protein family consisting of two RNA recognition motifs and four K homology domains and have been implicated in cytoplasmic mRNA localization, turnover and translational control. In

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique