Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

HPA010122

Sigma-Aldrich

Anti-DLG4 Antibody

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, rabbit polyclonal

Synonyme(s) :

Anti-Disks large homolog 4, Anti-PSD-95, Anti-Postsynaptic density protein 95, Anti-SAP90, Anti-Synapse-associated protein 90

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
HPA010122
Nomenclature NACRES :
NA.41

product name

Anti-DLG4 antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunohistochemistry: 1:200- 1:500

Séquence immunogène

HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR

Numéro d'accès UniProt

P78352

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... DLG4(1742)

Catégories apparentées

Description générale

DLG4 (discs large homolog 4) gene is localized to human chromosome 17p13.1. It is an abundantly present scaffolding protein. It is a multi-domain protein, which is a member of the membrane-associated guanylate kinase (MAGUK) family of proteins. This protein family is characterized by PSD-95/discs large/ZO-1 (PDZ)-Src homology 3 (SH3)-guanylate kinase domain. DLG4 is localized to the cytoplasmic ends of postsynaptic terminals.

Immunogène

Disks large homolog 4 recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

Actions biochimiques/physiologiques

Knockout (KO) mice for DLG4 (discs large homolog 4) are characterized by aberrant synaptic plasticity and impaired spatial learning. Polymorphisms in this gene at the core promoter region and the 3′ and 5′ UTR (untranslated regions) control its expression, which in turn is associated with susceptibility to schizophrenia. It couples the activity of N-methyl-D-aspartate receptors (NMDARs) to neurotoxicity by NO (nitric oxide), and is also responsible for specificity to excitotoxic Ca2+ signaling. This protein functions in the postsynapse at excitatory neurons, where it is responsible for the clustering of glutamate receptors and organization of macromolecular complexes for signal integration. In Alzheimer′s diseases, an increase in the expression of this protein is linked with increase in β-amyloid and phosphorylated Tau proteins.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71165

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

R Sattler et al.
Science (New York, N.Y.), 284(5421), 1845-1848 (1999-06-12)
The efficiency with which N-methyl-D-aspartate receptors (NMDARs) trigger intracellular signaling pathways governs neuronal plasticity, development, senescence, and disease. In cultured cortical neurons, suppressing the expression of the NMDAR scaffolding protein PSD-95 (postsynaptic density-95) selectively attenuated excitotoxicity triggered via NMDARs, but
Min-Chih Cheng et al.
PloS one, 5(12), e15107-e15107 (2010-12-15)
Hypofunction of N-methyl-D-aspartate (NMDA) receptor-mediated signal transduction has been implicated in the pathophysiology of schizophrenia. Post-synaptic density protein 95 (PSD95) plays a critical role in regulating the trafficking and activity of the NMDA receptor and altered expression of the PSD95
Jun Zhang et al.
The Journal of biological chemistry, 286(48), 41776-41785 (2011-10-04)
Postsynaptic density-95 is a multidomain scaffolding protein that recruits glutamate receptors to postsynaptic sites and facilitates signal processing and connection to the cytoskeleton. It is the leading member of the membrane-associated guanylate kinase family of proteins, which are defined by
Geneviève Leuba et al.
Neurobiology of disease, 30(3), 408-419 (2008-04-22)
In order to understand how plasticity is related to neurodegeneration, we studied synaptic proteins with quantitative immunohistochemistry in the entorhinal cortex from Alzheimer patients and age-matched controls. We observed a significant decrease in presynaptic synaptophysin and an increase in postsynaptic
C Fourie et al.
Journal of neurodegenerative diseases, 2014, 938530-938530 (2014-01-01)
NMDA and AMPA-type glutamate receptors and their bound membrane-associated guanylate kinases (MAGUKs) are critical for synapse development and plasticity. We hypothesised that these proteins may play a role in the changes in synapse function that occur in Huntington's disease (HD)
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique