Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV39466

Sigma-Aldrich

Anti-NR2F2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Nuclear receptor subfamily 2, group F, member 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Le tarif et la disponibilité ne sont pas disponibles actuellement.

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

46 kDa

Espèces réactives

dog, rabbit, human, guinea pig, sheep, horse, rat, mouse, bovine

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... NR2F2(7026)

Description générale

COUP transcription factor 2/nuclear receptor subfamily 2, group F, member 2 (COUP-TFII, NR2F2) is a nuclear receptor that regulates amygdale patterning via expression of neurophilin.COUP-TFII is a component of the glucagon-like peptide 1 (GLP-1) signaling cascade that stimulates neonatal β-cell number. COUP-TFII is required for GLP-1 activation of the β-catenin-dependent pathway.

Spécificité

Anti-NR2F2 (AB1) polyclonal antibody reacts with chicken, bovine, pig, zebrafish, human, mouse, rat, and canine COUP transcription factor 2 proteins.

Immunogène

Synthetic peptide directed towards the C terminal region of human NR2F2

Application

Anti-NR2F2 (AB1) polyclonal antibody is used to tag COUP transcription factor 2/nuclear receptor subfamily 2, group F, member 2 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of COUP transcription factor 2 in cell signaling pathways such as the glucagon-like peptide 1 (GLP-1) signaling cascade.

Actions biochimiques/physiologiques

NR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation.

Séquence

Synthetic peptide located within the following region: EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique