Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

AV32589

Sigma-Aldrich

Anti-CHEK1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-CHK1 checkpoint homolog (S. pombe)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Le tarif et la disponibilité ne sont pas disponibles actuellement.

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

54 kDa

Espèces réactives

rat, human, rabbit, mouse, horse, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CHEK1(1111)

Description générale

CHEK1 is a serine/threonine kinase that functions as a sensor for the stress response pathway in cells. It is activated by ATR kinase phosphorylation in response to DNA damage, and can subsequently modulate p53 phosphorylation. CHEK1 activity is inhibited by BCL6 in B cells.
Rabbit Anti-CHEK1 antibody recognizes zebrafish, bovine, chicken, human, mouse, rat, and canine CHEK1.

Immunogène

Synthetic peptide directed towards the middle region of human CHEK1

Application

Rabbit Anti-CHEK1 antibody can be used for western blot applications at a concentration of 0.5μg/ml. It can also be used for immunohistochemistry at 4-8μg/ml.

Actions biochimiques/physiologiques

CHEK1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage. Its expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.

Séquence

Synthetic peptide located within the following region: WSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLAL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Feng Li et al.
Nature communications, 12(1), 3845-3845 (2021-06-24)
Atr is a serine/threonine kinase, known to sense single-stranded DNA breaks and activate the DNA damage checkpoint by phosphorylating Chek1, which inhibits Cdc25, causing cell cycle arrest. This pathway has not been implicated in neuroregeneration. We show that in Drosophila
Stella M Ranuncolo et al.
Blood cells, molecules & diseases, 41(1), 95-99 (2008-03-19)
BCL6 is a transcriptional repressor protein that is expressed in a developmentally regulated fashion during B-cell maturation. Specifically, BCL6 is required for formation of germinal centers in response to T-cell dependent antigen activation. Germinal center B-cells feature the ability to
Hala Gali-Muhtasib et al.
Cancer research, 68(14), 5609-5618 (2008-07-18)
There are few reports describing the role of p53-dependent gene repression in apoptotic cell death. To identify such apoptosis-associated p53 target genes, we used the pro-oxidant plant-derived drug thymoquinone and compared p53+/+ and p53-/- colon cancer cells HCT116. The p53
Hanna Engqvist et al.
Frontiers in oncology, 10, 162-162 (2020-03-07)
Early-stage (I and II) ovarian carcinoma patients generally have good prognosis. Yet, some patients die earlier than expected. Thus, it is important to stratify early-stage patients into risk groups to identify those in need of more aggressive treatment regimens. The

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique