SAB2104288

Anti-THPO antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-MGC163194, Anti-MGDF, Anti-MKCSF, Anti-ML, Anti-MPLLG
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 35 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NM_000460
• UniProt-Hinterlegungsnummer: P40225
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... THPO(7066)

Beschreibung

Allgemeine Beschreibung

Thrombopoietin (TPO) is a lineage specific growth factor, produced in the liver, kidney and skeletal muscle. It is an acidic glycoprotein. The gene encoding it is localized on human chromosome 3q27.1.

Immunogen

Synthetic peptide directed towards the middle region of human THPO

Biochem./physiol. Wirkung

Thrombopoietin (TPO) stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the cellular proto-oncogene (c-mpl) receptor and acts as an important regulator of circulating platelets. High levels of TPO have been observed in patients with aplastic anemia.

Sequenz

Synthetic peptide located within the following region: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable