Direkt zum Inhalt
Merck

HPA038885

Sigma-Aldrich

Anti-YAP1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-YAP65

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.43

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Methode(n)

immunohistochemistry: 1:50- 1:200

Immunogene Sequenz

PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... YAP1(10413)

Allgemeine Beschreibung

Yes-associated protein 1 (YAP1) is a transcriptional coactivator and has two WW domains (two conserved tryptophans), TID domain (TEA domain family member 1 (TEAD) transcription factor interacting domain), proline rich region, sarcoma homology 3 domain (SH3) binding motif and post synaptic density protein (PSD95), Drosophila disc large tumor suppressor (Dlg1), and zonula occludens-1 protein motif (PDZ). It is expressed in eight isoforms. The gene YAP1 is mapped to human chromosome 11q22.1.

Immunogen

Yes-associated protein 1

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

Yes-associated protein 1 (YAP1) interacts with the src family kinase c-Yes by its SH3 binding motif and with protein 73 using WW motif. YAP promotes cell and tissue growth. YAP1 interacts with Receptor tyrosine-protein kinase (ErbB4) receptor and regulates transcription. YAP is oncogenic and contributes to tumor progression. Phosphorylation of YAP is critical for regulating apoptosis. YAP1 levels are elevated in human cancers. It is highly expressed in hedgehog-associated medulloblastomas. Mutations in YAP1 is also implicated in optic fissure closure defects. Knockdown of YAP1 gene impacts on prostate cancer progression and is considered as potential target for treatment.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST87319

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Analysenzertifikate (COA)

Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Yap1 phosphorylation by c-Abl is a critical step in selective activation of proapoptotic genes in response to DNA damage
Levy D, et al.
Molecular Cell, 29(3), 350-361 (2008)
JNK phosphorylates Yes-associated protein (YAP) to regulate apoptosis
Tomlinson V, et al.
Cell Death & Disease, 1(2), e29-e29 (2010)
WW domain-containing protein YAP associates with ErbB-4 and acts as a co-transcriptional activator for the carboxy-terminal fragment of ErbB-4 that translocates to the nucleus
Komuro A, et al.
The Journal of Biological Chemistry, 278(35), 33334-33341 (2003)
Inactivation of YAP oncoprotein by the Hippo pathway is involved in cell contact inhibition and tissue growth control
Zhao B, et al.
Genes & Development, 21(21), 2747-2761 (2007)
Heterozygous loss-of-function mutations in YAP1 cause both isolated and syndromic optic fissure closure defects
Williamson KA, et al.
American Journal of Human Genetics, 94(2), 295-302 (2014)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.