Direkt zum Inhalt
Merck
Alle Fotos(11)

Wichtige Dokumente

HPA019947

Sigma-Aldrich

Anti-RUVBL1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-49 kDa TATA box-binding protein-interacting protein, Anti-49 kDa TBP-interacting protein, Anti-ECP-54, Anti-INO80 complex subunit H, Anti-NMP 238, Anti-Pontin 52, Anti-RuvB-like 1, Anti-TAP54-alpha, Anti-TIP49a

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.43

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

independent
RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Methode(n)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500

Immunogene Sequenz

GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... RUVBL1(8607)

Allgemeine Beschreibung

RUVBL1 (RuvB-like AAA ATPase 1) is a 50kDa protein belonging to the AAA(+)-family of ATPases (ATPase associated with diverse cellular activities). It is composed of three functional domains, named as (DI, DII, and DIII domains. DII domain consists of 6 α-helices, 9 β-strands, and 2 very short 310-helices. Among all the domains, two domains are responsible for ATP binding and hydrolysis.

Immunogen

RuvB-like 1 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-RUVBL1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

RUVBL1 (RuvB-like AAA ATPase 1) is involved in various cellular processes including transcriptional regulation, DNA replication, DNA damage repair, chromatin remodeling and apoptosis. In the chromatin-remodeling process, it conjugates with other proteins to form the human histone acetylase/chromatin-remodeling complex TIP60, which plays an essential role in transcription and DNA repair. The chromatin-remodeling complex regulates chromatin structure as well as it maintains DNA-based export in the cell. It also functions as a component of the human RNA polymerase II holoenzyme complex, which indicates its role in transcriptional processes. RUVBL1 is also associated with two oncogenic pathways, c-Myc and another, β-catenin pathways. In addition, it also performs in small nucleolar ribonucleoprotein particle assembly, nucleolar localization, and trafficking.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST74004

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Reticulocytes Are an Enriched Source of the RUVBL1 Protein.
Beverly W Baron et al.
Acta haematologica, 138(3), 162-165 (2017-10-06)
Beverly W Baron et al.
Biochemistry and biophysics reports, 6, 1-8 (2016-04-12)
The human BCL6 gene, which is involved in the pathogenesis of certain human lymphomas, encodes a transcriptional repressor that is needed for germinal center B cell development and T follicular helper cell differentiation. Our goal was to identify BCL6 target
Keisuke Taniuchi et al.
International journal of oncology, 44(6), 1945-1954 (2014-04-15)
We report a novel function of RUVBL1 molecule in pancreatic cancer cells. Previous reports describe that RUVBL1 belongs to the family of AAA+ ATPases that associate with chromatin-remodelling complexes and have important roles in transcriptional regulation, the DNA damage response
Mingli Li et al.
Advanced science (Weinheim, Baden-Wurttemberg, Germany), 10(17), e2206584-e2206584 (2023-04-20)
Epigenetic dysregulation is reported in multiple cancers including Ewing sarcoma (EwS). However, the epigenetic networks underlying the maintenance of oncogenic signaling and therapeutic response remain unclear. Using a series of epigenetics- and complex-focused CRISPR screens, RUVBL1, the ATPase component of
Jirina Tyleckova et al.
International journal of molecular sciences, 13(12), 15536-15564 (2013-02-28)
A comprehensive proteome map of T-lymphoblastic leukemia cells and its alterations after daunorubicin, doxorubicin and mitoxantrone treatments was monitored and evaluated either by paired comparison with relevant untreated control and using multivariate classification of treated and untreated samples. With the

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.