HPA014018

Anti-HCRTR1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Hypocretin receptor type 1, Anti-Orexin receptor type 1, Anti-Ox1r
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA014018
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry: 1:20- 1:50
• Immunogene Sequenz: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV
• UniProt-Hinterlegungsnummer: O43613
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... HCRTR1(3061)

Beschreibung

Allgemeine Beschreibung

The expression of hypocretin receptor 1 has been observed in cerebral cortex, hippocampus, dorsal raphe, and ventral tegmental area. It is most abundantly expressed in the locus coeruleus.

Immunogen

Orexin receptor type 1 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-HCRTR1 antibody produced in rabbit has been used in a suspension bead array approach to profile serum and plasma proteins.
Anti-HCRTR1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

The gene HCRTR1 (hypocretin receptor 1) encodes a G-protein coupled receptor called as orexin receptor 1. It serves a s a receptor for orexin-A and orexin-B, with higher affinity for orexin-A. Orexin-A and orexin-B are neuromodulatory peptides that function in several processes including sleep-wake transitioning, regulation of food intake and autonomic output. Hcrtr1 signaling has been observed to be associated with cocaine seeking and the development of anhedonia. It may also be involved in the regulation of depression-like behavior. Mutations in the Hcrtr system has been implicated in Narcolepsy, a chronic sleep disorder. Polymorphism in HCRTR1 may be associated with a higher risk of polydipsia in Schizophrenia. The receptor-ligand complex also activates p38 mitogen-/stress-activated protein kinase and mediates caspase-dependent and -independent apoptosis.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST72745

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)