Direkt zum Inhalt
Merck

HPA003259

Sigma-Aldrich

Anti-MITF antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

MI, Microphthalmia-associated transcription factor, WS2, WS2A, bHLHe32

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

MDL-Nummer:
UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Methode(n)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

Immunogene Sequenz

HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT

UniProt-Hinterlegungsnummer

Anwendung(en)

research pathology

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... MITF(4286)

Allgemeine Beschreibung

MITF (microphthalmia-associated transcription factor) is a basic helix-loop-helix, leucine-zipper transcription factor. It is located on human chromosome 3p13.
Microphthalmia-associated transcription factor (MITF) is a bHLH-ZIP transcription factor that recognizes E-box (CAYRTG) and M-box (TCAYRTG or CAYRTGA) sequences in the promoter regions of target genes. Microphthalmia-associated transcription factor (MITF) is a master regulator in melanocyte proliferation, development, survival and melanoma formation and an essential regulator of osteoclastogenesis.
Rabbit polyclonal anti-MITF antibody recognizes human microphthalmia-associated transcription factor.

Immunogen

Microphthalmia-associated transcription factor recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-MITF antibody has been used in immunohistochemistry and chromatin immunoprecipitation.
Rabbit polyclonal anti-MITF antibody is used to tag microphthalmia-associated transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of microphthalmia-associated transcription factor in melanocyte proliferation, development, and survival and the regulation of regulator of osteoclastogenesis.

Biochem./physiol. Wirkung

MITF (microphthalmia-associated transcription factor) participates in the growth and differentiation of melanocytes. Mutations in MITF results in waardenburg syndrome type IIa.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST84788

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Analysenzertifikate (COA)

Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Melanocyte development in the mouse tail epidermis requires the Adamts9 metalloproteinase
Tharmarajah G, et al.
Pigment Cell & Melanoma Research (2018)
Human melanocytes mitigate keratinocyte-dependent contraction in an in vitro collagen contraction assay
Rakar J, et al.
Burns : Journal of the International Society For Burn Injuries, 41(5), 1035-1042 (2015)
The MITF, p. E318K Variant, as a Risk Factor for Pheochromocytoma and Paraganglioma.
Castro-Vega L J, et al.
The Journal of clinical endocrinology and metabolism, 101(12), 4764-4768 (2016)
Stefanie Riesenberg et al.
Nature communications, 6, 8755-8755 (2015-11-05)
Inflammation promotes phenotypic plasticity in melanoma, a source of non-genetic heterogeneity, but the molecular framework is poorly understood. Here we use functional genomic approaches and identify a reciprocal antagonism between the melanocyte lineage transcription factor MITF and c-Jun, which interconnects
Enhancer-targeted genome editing selectively blocks innate resistance to oncokinase inhibition
Webster D E, et al.
Genome Research, gr-166231 (2014)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.