Direkt zum Inhalt
Merck

HPA002548

Sigma-Aldrich

Anti-HUWE1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-ARF-BP1 antibody produced in rabbit, Anti-ARF-binding protein 1 antibody produced in rabbit, Anti-E3 ubiquitin-protein ligase HUWE1 antibody produced in rabbit, Anti-HECT, UBA and WWE domain-containing protein 1 antibody produced in rabbit, Anti-Mcl-1 ubiquitin ligase E3 antibody produced in rabbit, Anti-Mule antibody produced in rabbit, Anti-URE-B1 antibody produced in rabbit

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Methode(n)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Immunogene Sequenz

SGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLLGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVKVSIVNHLE

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... HUWE1(10075)

Allgemeine Beschreibung

HUWE1 (HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase) is an E3 ubiquitin ligase. It contains a region similar to the Bcl-2 homology region 3 (BH3) domain that interacts with Mcl-1 (myeloid cell leukemia 1).
HUWE1 is mapped on the human chromosome at Xp11.22. It has a molecular weight of 482 kDa.

Immunogen

E3 ubiquitin-protein ligase HUWE1 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-HUWE1 antibody produced in rabbit has been used to promote hexokinase 2′s (HK2′s) K63- linked ubiquitination.

Biochem./physiol. Wirkung

HUWE1 (HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase) is essential for DNA damage-induced apoptosis. It plays an important role in the stimulation of Mcl-1 polyubiquitination and regulation of apoptosis. It can directly bind with p53 to ubiquitinate it. It is inactivated by ARF and inactivation is crucial for ARF (alternative reading frame)-mediated p53 stabilization. It polyubiquitinates Cdc6 (cell division cycle 6) in vitro which is an essential component of pre-replication complexes (preRCs) during initial phase of DNA replication. The polyubiquitination helps HUWE1 to control availability of Cdc6 in post DNA damage condition.
HUWE1 is involved in base excision repair, cell proliferation and DNA damage response. The mutation in this gene is associated with Juberg-Marsidi and Brooks syndromes.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST74283

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Analysenzertifikate (COA)

Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

HUWE1 mutations in Juberg-Marsidi and Brooks syndromes: the results of an X-chromosome exome sequencing study
Friez M J, et al.
BMJ Open, 6(4), e009537-e009537 (2016)
HUWE1 variants cause dominant X-linked intellectual disability: a clinical study of 21 patients
Moortgat S, et al.
European Journal of Human Genetics, 26(1), 64-64 (2018)
A structural element within the HUWE1 HECT domain modulates self-ubiquitination and substrate ubiquitination activities
Pandya R K, et al.
Test, 285(8), 5664-5673 (2010)
Non-proteolytic ubiquitination of Hexokinase 2 by HectH9 controls tumor metabolism and cancer stem cell expansion
Lee H J, et al.
Nature Communications, 10(1), 2625-2625 (2019)
Delin Chen et al.
Cell, 121(7), 1071-1083 (2005-07-02)
Although the importance of the ARF tumor suppressor in p53 regulation is well established, numerous studies indicate that ARF also suppresses cell growth in a p53/Mdm2-independent manner. To understand the mechanism of ARF-mediated tumor suppression, we identified a ubiquitin ligase

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.