HPA001171

Anti-PLA2G6 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-NBIA2, Anti-PARK14, Anti-PNPLA9, Anti-iPLA2, Anti-iPLA2beta, PLA2G6 Antibody - Anti-PLA2G6 antibody produced in rabbit, Pla2G6 Antibody
• MDL-Nummer: MFCD00803786
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA001171
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; recombinant expression; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL
• Immunogene Sequenz: QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
• UniProt-Hinterlegungsnummer: O60733
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PLA2G6(8398)

Beschreibung

Allgemeine Beschreibung

PLA2G6 (phospholipase A2, group VI) localizes in the mitochondria.

Immunogen

85 kDa calcium-independent phospholipase A2 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-PLA2G6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

PLA2G6 (phospholipase A2, group VI) gene encodes a phospholipase that catalyzes the release of fatty acids from phospholipids. The protein may function in phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release. It is also involved in leukotriene and prostaglandin synthesis. It may have a role in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. It is also involved in cardiolipin (CL) deacylation. Mutations in PLA2G6 are associated with infantile neuroaxonal dystrophy, neurodegeneration with brain iron accumulation type II and autosomal recessive early-onset dystonia-parkinsonism. Loss of PLA2G6 gene activity causes lipid peroxidation, mitochondrial dysfunction and thereby mitochondrial membrane abnormalities. It is also involved in type 1 diabetes, by participating in endoplasmic reticulum stress-induced β-cell apoptosis.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST73385

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)