AV46056

Anti-EIF2S3 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-EIF2, Anti-EIF2G, Anti-EIF2gamma, Anti-Eukaryotic translation initiation factor 2, subunit 3 γ, 52 kDa
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 51 kDa
• Speziesreaktivität: human, dog, rat, bovine, rabbit, guinea pig, mouse, horse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_001406
• UniProt-Hinterlegungsnummer: P41091
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... EIF2S3(1968)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human EIF2S3

Anwendung

Anti-EIF2S3 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml.

Biochem./physiol. Wirkung

EIF2S3 gene encodes a eukaryotic translation initiation factor 2, subunit 3 gamma protein of 52kDa. It is the core subunit of the heterotrimeric GTP-binding protein that facilitates the recruitment of methionyl-tRNA to the 40S ribosomal subunit.

Sequenz

Synthetic peptide located within the following region: LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable