Direkt zum Inhalt
Merck

AV44743

Sigma-Aldrich

Anti-TGFBR2 antibody produced in rabbit

IgG fraction of antiserum

Synonym(e):

Anti-HNPCC6, Anti-MFS2, Anti-RIIC, Anti-Tbeta, Anti-Transforming growth factor, β receptor II (70/80 kDa)

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

IgG fraction of antiserum

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Form

buffered aqueous solution

Mol-Gew.

62 kDa

Speziesreaktivität

rabbit, human

Konzentration

0.5 mg - 1 mg/mL

Methode(n)

western blot: suitable

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... TGFBR2(7048)

Verwandte Kategorien

Allgemeine Beschreibung

Transforming growth factor, β receptor II (70/80 kDa) (TGFBR2, HNPCC6, MFS2, RIIC) is a transmembrane ser/thr protein kinase family receptor for TGF-β (TGFB). TGFBR2 mediate TGF-β cell signaling to regulate/inhibit cell proliferation. Defective TGFBR2 is associated with Marfan syndrome.

Spezifität

Anti-TGFBR2 polyclonal antibody reacts with bovine, rabbit, human, mouse, rat, and pig transforming growth factor, β receptor II proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human TGFBR2

Anwendung

Anti-TGFBR2 polyclonal antibody is used to tag transforming growth factor, β receptor II for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transforming growth factor, β receptor II in TGF-β signaling and regulation of cell proliferation.

Biochem./physiol. Wirkung

TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in its gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.This gene is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It encodes a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein and binds TGF-beta. This receptor/ligand complex phosphorylates proteins which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Sequenz

Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 3

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Jing Yang et al.
Cell death & disease, 10(8), 558-558 (2019-07-25)
Natriuretic peptide type C (NPPC) secreted by mural granulosa cells (MGCs) maintains oocyte meiotic arrest via the activation of guanylyl cyclase-linked natriuretic peptide receptor 2 (NPR2). Here, we investigated the effect of transforming growth factor (TGF)-β on NPPC expression in
Luke D Halder et al.
Nature communications, 11(1), 2331-2331 (2020-05-13)
Extracellular vesicles have an important function in cellular communication. Here, we show that human and mouse monocytes release TGF-β1-transporting vesicles in response to the pathogenic fungus Candida albicans. Soluble β-glucan from C. albicans binds to complement receptor 3 (CR3, also
Peng Li et al.
Stem cell research & therapy, 10(1), 144-144 (2019-05-23)
Non-small cell lung cancer (NSCLC) is the second most prevalent cause of cancer-related fatality. Long non-coding RNAs (lncRNAs) have been observed to exercise functions in NSCLC. Here, the current study aimed to explore the potential mechanism of lncRNA MBNL1-AS1 in

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.