AV38692

Anti-SMAD1 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-BSP1, Anti-JV4-1, Anti-JV41, Anti-MADH1, Anti-MADR1, Anti-SMAD family member 1
• UNSPSC-Code: 12352203
• NACRES: NA.41
• Konjugat: unconjugated
• application: IHC; WB
• Klon: polyclonal
• Speziesreaktivität: rat, mouse, human, dog, rabbit, guinea pig, bovine, horse
• citations: 2
• Methode(n): immunohistochemistry: suitable; western blot: suitable

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 52 kDa
• Speziesreaktivität: rat, mouse, human, dog, rabbit, guinea pig, bovine, horse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_001003688
• UniProt-Hinterlegungsnummer: Q99717
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SMAD1(4086)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human SMAD1

Biochem./physiol. Wirkung

SMAD proteins are transcription regulators that mediate multiple signal transduction pathways. They are involved in a wide variety of cellular processes such as cell growth, apoptosis, survival, differentiation, morphogenesis and immune responses. SMAD1 interacts with PAWS1/FAM83G protein and regulates bone morphogenetic protein signaling.

Sequenz

Synthetic peptide located within the following region: MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEE

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable