SAB2102490

Anti-TNFRSF21 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-BM-018, Anti-DR6, Anti-MGC31965, Anti-Tumor necrosis factor receptor superfamily, member 21
• MDL number: MFCD02686099
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 68 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: O75509
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TNFRSF21(27242)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human TNFRSF21

Biochem/physiol Actions

TNFRSF21 is a member of the TNF-receptor superfamily. This receptor has been shown to activate¡¡NF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction of¡¡TNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction of TNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation.

Sequence

Synthetic peptide located within the following region: TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable