SAB1405974
Anti-HTN1 antibody produced in mouse
purified immunoglobulin, buffered aqueous solution
Synonym(s):
HIS1
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Pricing and availability is not currently available.
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
antigen ~7 kDa
species reactivity
human
technique(s)
western blot: 1 μg/mL
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... HTN1(3346)
Related Categories
General description
Histatin 1 (HTN1) is a histidine-rich phosphoprotein.HTN1 functions as an antimicrobial peptide with 38 amino acids. It is highly enriched in human saliva. HTN1 gene is located on human chromosome 4q13.3.
Immunogen
HTN1 (NP_002150.1, 1 a.a. ~ 57 a.a) full-length human protein.
Sequence
MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
Sequence
MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
Biochem/physiol Actions
Histatin 1 (HTN1) promotes migration of oral keratinocytes and fibroblasts in vitro. It also contributes to endothelial cell adhesion, migration and angiogenesis. HTN1 helps in oral wound healing. HTN1 is used as a marker for human lacrimal epithelium in accessory lacrimal gland (ALG) and cadaveric main lacrimal gland (MLG). HTN1 also has candidacidal activity and helps in mineralization by adsorbing to hydroxyapatite.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
A review of protein structure and gene organisation for proteins associated with mineralised tissue and calcium phosphate stabilisation encoded on human chromosome 4
Huq N, et al.
Archives of Oral Biology, 50(7) (2005)
The salivary peptide histatin-1 promotes endothelial cell adhesion, migration, and angiogenesis
Torres , et al.
Faseb Journal, 31(11) (2017)
Histatin-1 expression in human lacrimal epithelium
Shah D, et al.
PLoS ONE, 11(1), e0148018-e0148018 (2016)
Sushma Kalmodia et al.
Scientific reports, 9(1), 10304-10304 (2019-07-18)
The aims of this study were to determine if histatin-1 (H1) is present in normal human tears and whether tear levels of H1 varied between normal patients and those with aqueous deficient dry eye disease (ADDE). Patient samples were obtained
Menno J Oudhoff et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 22(11), 3805-3812 (2008-07-25)
Wounds in the oral cavity heal much faster than skin lesions. Among other factors, saliva is generally assumed to be of relevance to this feature. Rodent saliva contains large amounts of growth factors such as epidermal growth factor (EGF) and
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
