SAB1402583

Monoclonal Anti-VGLL1, (N-terminal) antibody produced in mouse

clone 3C7, purified immunoglobulin, buffered aqueous solution

• Synonym(s): TDU, VGL1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3C7, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: NM_016267
• UniProt accession no.: Q99990
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... VGLL1(51442)

Description

General description

Vestigial like family member 1 (VGLL1) is a transcriptional coactivator which is related to the Drosophila transcriptional co-activator Vg. The gene encoding it is localized on human chromosome Xq26.3.

Immunogen

VGLL1 (NP_057351.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEEMKKTAIRLPKGKQKPIKTEWNSRCVLFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPNQWRYSSPWTKPQPEVPVTNRAA

Biochem/physiol Actions

Vestigial like family member 1 (VGLL1) may function as a coactivator for TEA domain family of transcription factors (TEFs). It has been associated with breast cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable