Skip to Content
Merck
All Photos(1)

Documents

HPA015480

Sigma-Aldrich

Anti-SERPINB2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Monocyte Arg-serpin, Anti-PAI-2, Anti-Placental plasminogen activator inhibitor, Anti-Plasminogen activator inhibitor 2 precursor, Anti-Urokinase inhibitor

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:500- 1:1000

immunogen sequence

TQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SERPINB2(5055)

General description

SERPINB2 (serpin peptidase inhibitor B2) is a member of a large family of proteins called serine protease inhibitors (serpins), the members of which are structurally related. It has a constitutive expression in only certain cell types such as, trophoblasts, neurons, pre-adipocytes, macrophages and keratinocytes. When localized intracellularly, it has a molecular weight of 47kDa, and is non-glycosylated. The secreted form is 60kDa, and is glycosylated. It has a C-D loop, which are α-helices acting as bridges between domains.

Immunogen

Plasminogen activator inhibitor 2 precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-SERPINB2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

SERPINB2 (serpin peptidase inhibitor B2) functions as a suppressor of urokinase type plasminogen activator. It is involved in the survival of macrophages, differentiation of keratinocytes and monocytes, signaling pathways, apoptosis and cellular protection. It also has an immunomodulatory role, and aberrant expression of this protein is linked to asthma, pre-eclampsia, periodontal disease, and cancer. Its expression is induced by the carcinogen PMA (phorbol 12-myristate 13-acetate) in multiple cell types such as, monocytic lineage cells. In endothelial cells, it binds to proteasome complex, and thus, affects its activity. As proteasome activity determines the apoptotic fate of cells, elevated expression of this protein in endothelial cells might favor apoptosis. The expression of this protein is elevated in cervical cancer, and this is linked to high-risk human papillomavirus (HPV) and cervical lesion grade.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71128

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Henriette Poaty et al.
PloS one, 7(1), e29426-e29426 (2012-01-19)
Eleven samples of DNA from choriocarcinomas were studied by high resolution CGH-array 244 K. They were studied after histopathological confirmation of the diagnosis, of the androgenic etiology and after a microsatellite marker analysis confirming the absence of contamination of tumor
Stina Syrjänen et al.
American journal of clinical pathology, 132(6), 883-892 (2009-11-21)
Protease inhibitor serpin-B2 (plasminogen activator inhibitor-2 [PAI-2]) protects pRb from degradation in human papillomavirus (HPV)-18+ HeLa cells. Our objective was to assess whether the pRb-mediated HPV-suppressive effect of PAI-2 in cancer cell lines has implications in the outcome of HPV
Brett Stringer et al.
The Journal of biological chemistry, 287(13), 10579-10589 (2012-02-16)
Transcriptional up-regulation of the plasminogen activator inhibitor type-2 (PAI-2) gene is a major response to cellular stress. The expression of PAI-2 is induced by a variety of cytokines and growth factors that act in a cell type- and differentiation stage-dependent
Joanna Boncela et al.
The Journal of biological chemistry, 286(50), 43164-43171 (2011-10-07)
Quiescent endothelial cells contain low concentrations of plasminogen activator inhibitor type 2 (PAI-2). However, its synthesis can be rapidly stimulated by a variety of inflammatory mediators. In this study, we provide evidence that PAI-2 interacts with proteasome and affects its
Remedios Castello-Cros et al.
Cell cycle (Georgetown, Tex.), 10(12), 2021-2034 (2011-06-08)
We have previously demonstrated that loss of stromal caveolin-1 (Cav-1) in cancer-associated fibroblasts is a strong and independent predictor of poor clinical outcome in human breast cancer patients. However, the signaling mechanism(s) by which Cav-1 downregulation leads to this tumor-promoting

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service