Skip to Content
Merck
All Photos(3)

Documents

HPA014790

Sigma-Aldrich

Anti-KIDINS220 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Ankyrin repeat-rich membrane spanning protein, Anti-Kinase D-interacting substrate of 220 kDa

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

EPLLEIDGDIRNFEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

KIDINS220 (kinase D-interacting substrate, 220kDa) is a newly discovered protein, which has a predominant expression in the developing nervous system. This gene is localized to human chromosome 2q. The encoded protein is of 22kDa, and is composed of three functional domains. One domain acts as a scaffold for MAPK/ERK (extracellular signal-regulated kinase (ERK) kinase) signaling cascade, and also interacts with Trk, Eph, and VEGF (vascular endothelial growth factor). It has a kinesin binding domain, which also interacts with microtubule associated proteins (MAPs). The last domain is an ankyrin rich domain, present in the N-terminal and interacts with Trio, which is a RhoGEF. It has four transmembrane regions, and both N- and C-termini face the cytoplasm.

Immunogen

Ankyrin repeat-rich membrane spanning protein recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

KIDINS220 (kinase D-interacting substrate, 220kDa) is a ligand for tyrosine kinase receptors in neurons. It plays an essential role in the development and survival of neurons, by mediating neurotrophic signaling. It is expressed in neuroblastoma and facilitates neuroblastoma cell survival, through nerve growth factor (NGF)-mediated signaling. In neural crest tumors, it is responsible for the neuroblastic (N-type) cell to Schwannian stromal (S-type) cell transition. It is also up-regulated in melanoma, and facilitates melanoma migration and invasiveness via, extracellular signal-regulated kinase (ERK) (MEK)/ERK signaling pathway. It is hypothesized that KIDINS220 plays a role in regulating cytoskeleton dynamics, thus affecting cell movement in both pathological and normal conditions. Excitotoxicity and cerebral ischaemia lead to suppression of this protein, which results in neuronal death. In Alzheimer′s disease (AD), KIDINS220 accumulates along with tau protein, due to resistance to calpain processing. Thus, it has potential as a therapeutic target in AD.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73113

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Danny A Rogers et al.
Pediatric research, 74(5), 517-524 (2013-09-04)
Neurotrophic signaling is an important factor in the survival of developing neurons, and the expression of neurotrophic receptors correlates with prognosis in neuroblastoma. Kinase D-interacting substrate of 220 kDa (Kidins220) associates with neurotrophic receptors and stabilizes them, but the expression and
Veronika E Neubrand et al.
Journal of cell science, 125(Pt 8), 1845-1854 (2012-05-09)
An increasing body of evidence suggests that several membrane receptors--in addition to activating distinct signalling cascades--also engage in substantial crosstalk with each other, thereby adjusting their signalling outcome as a function of specific input information. However, little is known about
Y H Liao et al.
British journal of cancer, 104(6), 982-988 (2011-02-24)
We have previously demonstrated that overexpression of ankyrin repeat-rich membrane spanning (ARMS) protein facilitates melanoma formation via conferring apoptotic resistance. This study aims to investigate whether ARMS contributes to melanoma progression. Using immunohistochemistry, we graded the expression level of ARMS
Danny A Rogers et al.
Experimental cell research, 319(5), 660-669 (2013-01-22)
Peripheral neuroblastic tumors exist as a heterogeneous mixture of neuroblastic (N-type) cells and Schwannian stromal (S-type) cells. These stromal cells not only represent a differentiated and less aggressive fraction of the tumor, but also have properties that can influence the
Celia López-Menéndez et al.
Human molecular genetics, 22(3), 466-482 (2012-11-03)
Failures in neurotrophic support and signalling play key roles in Alzheimer's disease (AD) pathogenesis. We previously demonstrated that downregulation of the neurotrophin effector Kinase D interacting substrate (Kidins220) by excitotoxicity and cerebral ischaemia contributed to neuronal death. This downregulation, triggered

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service