LGALS8 (lectin, galactoside-binding, soluble, 8) encodes a protein that belongs to galectin family and is predominantly expressed in tumoral tissues and may be involved in integrin-like cell interactions.
The previously assigned protein identifier Q9BXC8 has been merged into O00214. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the C terminal region of human LGALS8
Application
Anti-LGALS8 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
Gal-8 activates Rho signaling in TM cells and hence facilitates the regulation of cytoskeletal rearrangement in trabecular meshwork cells. Galectin-8 interacts with integrin and modulates its interaction with the extracellular matrix and hence inhibits cell adhesion and induces apoptosis. Additionally, it also has a role in modulating cell adhesion and cell growth.
Sequence
Synthetic peptide located within the following region: FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Galectin-8 belongs to the family of tandem-repeat type galectins. It consists as several isoforms, each made of two domains of approximately 140 amino-acids, both having a carbohydrate recognition domain (CRD). These domains are joined by a 'link peptide' of variable
The trabecular meshwork (TM) cell-matrix interactions and factors that influence Rho signaling in TM cells are thought to play a pivotal role in the regulation of aqueous outflow. The current study was designed to evaluate the role of a carbohydrate-binding
Journal of cell science, 113 ( Pt 13), 2385-2397 (2000-06-15)
The interaction of cells with the extracellular matrix regulates cell adhesion, motility, growth, survival and differentiation through integrin-mediated signal transduction. Here we demonstrate that galectin-8, a secreted mammalian (beta)-galactoside binding protein, inhibits adhesion of human carcinoma (1299) cells to plates
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.