Skip to Content
Merck
All Photos(1)

Key Documents

AV50062

Sigma-Aldrich

Anti-ZDHHC16 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-APH2, Anti-MGC2993, Anti-Zinc finger, DHHC-type containing 16

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

44 kDa

species reactivity

rat, bovine, dog, guinea pig, mouse, goat, rabbit, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZDHHC16(84287)

Immunogen

Synthetic peptide directed towards the N terminal region of human ZDHHC16

Application

Anti-ZDHHC16 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Zinc finger, DHHC-type containing 16 (ZDHHC16; APH2; DHHC-16) is c-Abl interacting protein that is localized to endoplasmic reticulum. It may be involved in ER stress-induced apoptosis and exhibit pro-apoptotic activity. It may also interact with JAB1 protein and negatively regulate the activation of AP-1.

Sequence

Synthetic peptide located within the following region: SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yan Sun et al.
Cell reports, 40(7), 111194-111194 (2022-08-18)
Sorafenib is currently the first-line treatment for advanced hepatocellular carcinoma (HCC). However, sorafenib resistance remains a significant challenge. Aberrant AKT signaling activation is a crucial mechanism driving sorafenib resistance in HCC. Proprotein convertase subtilisin/kexin type 9 (PCSK9) plays a vital
Baojie Li et al.
The Journal of biological chemistry, 277(32), 28870-28876 (2002-05-22)
c-Abl is a non-receptor tyrosine kinase implicated in DNA damage-induced cell death and in growth factor receptor signaling. To further understand the function and regulation of c-Abl, a yeast two-hybrid screen was performed to identify c-Abl-interacting proteins. Here we report
Fengrui Zhang et al.
Biochimica et biophysica acta, 1759(11-12), 514-525 (2006-11-25)
A human Aph2 gene (hAph2) was identified and cloned from a human placenta cDNA library. Bioinformatics analysis revealed hAPH2 protein shares 96% identity with mouse APH2 and contains a zf-DHHC domain (148-210aa), which is always involved in protein-protein or protein-DNA

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service