NR5A2 belongs to the nuclear receptor subfamily. It has been implicated in acinar cell differentiation and pancreatic carcinogenesis. Rabbit Anti-NR5A2 (AB2) antibody recognizeschicken, human, mouse, and rat NR5A2.
Immunogen
Synthetic peptide directed towards the middle region of human NR5A2
Application
Rabbit Anti-NR5A2 (AB2) antibody can be used for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
NR5A2 binds to the sequence element 5′-AACGACCGACCTTGAG-3′ of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. It may be responsable for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. It is a key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.
Sequence
Synthetic peptide located within the following region: LPPTDYDRSPFVTSPISMTMLHGSLQGYQTYGHFPSRAIKSEYPDPYTSS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nr5a2 participates in biliary acid metabolism and is a major regulator of the pancreatic exocrine programme. Single nucleotide polymorphisms in the vicinity of NR5A2 are associated with the risk of pancreatic ductal adenocarcinoma (PDAC). To determine the role of Nr5a2
Emerging evidence from mouse models suggests that mutant Kras can drive the development of pancreatic ductal adenocarcinoma (PDA) precursors from acinar cells by enforcing ductal de-differentiation at the expense of acinar identity. Recently, human genome-wide association studies have identified NR5A2
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
