Skip to Content
Merck
All Photos(7)

Key Documents

HPA004114

Sigma-Aldrich

Anti-MRC1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-C-type lectin domain family 13 member D, Anti-CD206 antigen, Anti-MMR, Anti-Macrophage mannose receptor 1 precursor

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:1000-1:2500

immunogen sequence

NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MRC1(4360)

General description

Mannose receptor, C type 1 (MRC1) is a trans-membrane glycoprotein, that is expressed at high levels in the M2 macrophages. This functional gene has 30 exons and is of 101.74 kb. MRC1 consists of a ricin b-type lectin domain (RICIN), a fibronectin type-II domain (FN2), 8 C-type lectin-like domains (CTLDs), a single transmembrane domain (TM) and a short cytosolic domain. It is also expressed on endothelial cells and plasma membrane. This gene is located on human chromosome 10p12.

Immunogen

Macrophage mannose receptor 1 precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-MRC1 antibody has been used:
  • in immunofluorescence Ab staining
  • in confocal microscopy
  • in immunohistochemical staining

Biochem/physiol Actions

Mannose receptor, C type 1 (MRC1) encodes for human mannose receptor (MR) and is a member of the C-type lectin receptors family. It recognizes and binds to Mycobacterium tuberculosis by the extracellular structure. It plays a role in antigen-presenting and maintaining a stable internal environment. It plays a critical role in controlling immune response and in regulating allergen induced allergic responses in asthma. This gene along with HSP70 family members through the receptor cytoplasmic tail may contribute to MR trafficking in macrophages.
Mannose receptor, C type 1 (MRC1) is involved in phagocytosis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86249

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Li Liu et al.
JCI insight, 4(4) (2019-03-05)
Newly emerging viruses, such as severe acute respiratory syndrome coronavirus (SARS-CoV), Middle Eastern respiratory syndrome CoVs (MERS-CoV), and H7N9, cause fatal acute lung injury (ALI) by driving hypercytokinemia and aggressive inflammation through mechanisms that remain elusive. In SARS-CoV/macaque models, we
M Mark et al.
ESMO open, 7(3), 100446-100446 (2022-04-16)
The SAKK 17/16 study showed promising efficacy data with lurbinectedin as second- or third-line palliative therapy in malignant pleural mesothelioma. Here, we evaluated long-term outcome and analyzed the impact of lurbinectedin monotherapy on the tumor microenvironment at the cellular and
The sdLDL reduces MRC1 expression level and secretion of Histamin e in differentiated M2-macrophages from patients with coronary artery stenosis
Yarnazari A, et al.
Cardiovascular & Hematological Disorders Drug Targets, 17(1), 28-32 (2017)
Ying-Ming Tsai et al.
PloS one, 8(5), e64105-e64105 (2013-06-05)
The innate pattern recognition C-type-lectin receptors (CLRs), including mannose receptor (MRC1; CD206), have been suggested to functionally interact with allergens and are critical in controlling immune response. Fibrocytes have been considered to play a role in allergic asthma. Here we
Netrin-1 is associated with macrophage infiltration and polarization in human epicardial adipose tissue in coronary artery disease
Gurses K M, et al.
Journal of Cardiology, 69(6), 851-858 (2017)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service