Skip to Content
Merck
All Photos(3)

Key Documents

WH0003280M1

Sigma-Aldrich

Monoclonal Anti-HES1 antibody produced in mouse

clone 4D9, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-FLJ20408, Anti-HES1, Anti-HHL, Anti-HRY, Anti-hairy and enhancer of split 1, (Drosophila)

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4D9, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HES1(3280)

General description

Hairy and enhancer of split-1 (HES1) is a transcriptional repressor. It is a member of the basic helix-loop-helix family of transcription factors. This gene is mapped to human chromosome 3q29.
This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. (provided by RefSeq)

Immunogen

HES1 (NP_005515, 36 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH

Application

Monoclonal Anti-HES1 antibody has been used in western blotting.

Biochem/physiol Actions

Hairy and enhancer of split-1 (HES1) is required for regulating NPC (neural progenitor cells) fate and fetal brain development. This gene also helps to maintain the undifferentiated and proliferative status of NPCs. Absence of HES1 is linked with poor prognosis in colorectal adenocarcinoma.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Loss of Hes1 expression is associated with poor prognosis in colorectal adenocarcinoma
Ahadi M, et al.
Human Pathology (2016)
HES1 promotes extracellular matrix protein expression and inhibits proliferation and migration in human trabecular meshwork cells under oxidative stress
Xu L, et al.
Oncotarget, 8(13), 21818-21833 (2017)
Anti-correlation between longevity gene SirT1 and Notch signaling in ascending aorta biopsies from patients with bicuspid aortic valve disease
Sciacca S, et al.
Heart and Vessels, 28(2), 268-275 (2013)
[Identification of a novel deletion region in 3q29 microdeletion syndrome by oligonucleotide array comparative genomic hybridization]
Seo EJ, et al.
The Korean Journal of Laboratory Medicine, 30(1), 70-75 (2010)
Human cytomegalovirus IE1 downregulates Hes1 in neural progenitor cells as a potential E3 ubiquitin ligase
Liu XJ, et al.
PLoS Pathogens (2017)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service