Skip to Content
Merck
All Photos(2)

Key Documents

AV32404

Sigma-Aldrich

Anti-LEF1 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Lef1 Antibody, Lef1 Antibody - Anti-LEF1 (AB1) antibody produced in rabbit, Anti-Lymphoid enhancer-binding factor 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

44 kDa

species reactivity

human, dog, bovine, goat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LEF1(51176)

General description

LEF1 is a transcription factor that interacts with β-catenin and modulates cell adhesion. This transcription factor also mediates nuclear responses via the Wnt signaling pathway.
Rabbit Anti-LEF1 (AB1) antibody recognizes chicken, human, mouse, rat, canine, rabbit, bovine, zebrafish, and pig LEF1.

Immunogen

Synthetic peptide directed towards the middle region of human LEF1

Application

Rabbit Anti-LEF1 (AB1) antibody can be used for IHC (4-8μg/ml) and western blot (0.1-2.0μg/ml) applications.

Biochem/physiol Actions

Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1).

Sequence

Synthetic peptide located within the following region: ADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Q Eastman et al.
Current opinion in cell biology, 11(2), 233-240 (1999-04-21)
LEF-1/TCF transcription factors mediate a nuclear response to Wnt signals by interacting with beta-catenin. Wnt signaling and other cellular events that increase the stability of beta-catenin result in transcriptional activation by LEF-1/TCF proteins in association with beta-catenin. In the absence
J Behrens et al.
Nature, 382(6592), 638-642 (1996-08-15)
The cytoplasmic proteins beta-catenin of vertebrates and armadillo of Drosophila have two functions: they link the cadherin cell-adhesion molecules to the cytoskeleton, and they participate in the wnt/wingless signal pathway. Here we show, in a yeast two-hybrid screen, that the
Patience Meo Burt et al.
Endocrinology, 159(6), 2386-2396 (2018-05-03)
Although humans with X-linked hypophosphatemia (XLH) and the Hyp mouse, a murine homolog of XLH, are known to develop degenerative joint disease, the exact mechanism that drives the osteoarthritis (OA) phenotype remains unclear. Mice that overexpress high-molecular-weight fibroblast growth factor

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service