Skip to Content
Merck
All Photos(4)

Key Documents

WH0005156M1

Sigma-Aldrich

Monoclonal Anti-PDGFRA antibody produced in mouse

clone 2D2-1A11, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-CD140A, Anti-MGC74795, Anti-PDGFR2, Anti-platelet-derived growth factor receptor, alpha polypeptide

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2D2-1A11, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PDGFRA(5156)

General description

This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies in knockout mice, where homozygosity is lethal, indicate that the alpha form of the platelet-derived growth factor receptor is particularly important for kidney development since mice heterozygous for the receptor exhibit defective kidney phenotypes. (provided by RefSeq)
Platelet-derived growth factor receptor α (PDGFRA) is also termed as cluster of differentiation 140a (CD140a). It is is encoded by the gene mapped to human chromosome 4q12. The encoded protein belongs to the receptor tyrosine kinase gene family.

Immunogen

PDGFRA (AAH15186, 25 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL

Biochem/physiol Actions

Platelet-derived growth factor receptor α (PDGFRA) plays a vital role in the development and maturation of platelets. It serves as a potential target for imatinib, a revolutionary drug for the treatment of chronic myeloid leukemia. PDGFRA pathway may participate in the developmental process of thrombocytes. Mutation in the gene results in gastrointestinal stromal tumors (GISTs).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

PDGFRα promoter polymorphisms and expression patterns influence risk of development of imatinib-induced thrombocytopenia in chronic myeloid leukemia: A study from India.
Guru SA, et al.
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine, 39(10), 1010428317713857-1010428317713857 (2017)
PDGFRA Mutations in Gastrointestinal Stromal Tumors: Frequency, Spectrum and In Vitro Sensitivity to Imatinib
Corless C L, et al.
Journal of Clinical Oncology, 23(23), 5357-5364 (2005)
A 1.8-Mb YAC contig spanning three members of the receptor tyrosine kinase gene family (Pdgfra, Kit, and Flk1) on mouse chromosome 5.
Brunkow M E, et al.
Genomics, 25(2), 421-432 (1995)
Platelet-Derived Growth Factor Receptor ? Contributes to Human Hepatic Stellate Cell Proliferation and Migration.
Kikuchi A, et al.
The American Journal of Pathology, 187(10), 2273-2287 (2017)
Overexpressed Skp2 within 5p amplification detected by array?based comparative genomic hybridization is associated with poor prognosis of glioblastomas
Saigusa K, et al.
Cancer Science, 96(10), 676-683 (2005)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service