HPA045153
Anti-PRAME antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Prame Antibody, Prame Antibody - Anti-PRAME antibody produced in rabbit, Anti-Ct130, Anti-Mape, Anti-Preferentially expressed antigen in melanoma
Sign Into View Organizational & Contract Pricing
All Photos(5)
About This Item
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
immunogen sequence
LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI
UniProt accession no.
application(s)
research pathology
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PRAME(23532)
General description
The gene PRAME (preferentially expressed antigen in melanoma) is mapped to human chromosome 22q11. The encoded protein belongs to the cancer D testis antigen family. It is a tumor-associated antigen. PRAME has very low or no expression in normal tissues.
PRAME protein interacts with:
PRAME protein interacts with:
- CUL2 (anti-CUL2 HPA024578)
- TCEB1 (anti-TCEB1 HPA078113)
- TCEB2 (anti-TCEB2 SAB1409726)
Immunogen
preferentially expressed antigen in melanoma recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-PRAME antibody produced in rabbit has been used in western blotting, immunohistochemistry and immunofluorescence.
Anti-PRAME antibody produced in rabbit has been used in western blotting, immunohistochemistry and immunofluorescence.
Biochem/physiol Actions
PRAME (preferentially expressed antigen in melanoma) is overexpressed in malignant cells, including primary and metastatic melanomas, acute and chronic leukaemias, Hodgkin′s lymphoma, breast cancer and head and neck squamous cell carcinomas. In AML (acute myeloid leukemia), high levels of PRAME are associated with lower relapse rate and high chances of disease-free survival. PRAME also plays a role in the retinol pathway. It modulates the metabolism of all-trans retinol (vitamin A) and its active metabolites, referred to as retinoids. It is a repressor of retinoic acid receptor signaling.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST70289
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Y Xu et al.
European review for medical and pharmacological sciences, 20(6), 1057-1063 (2016-04-07)
PRAME (Preferentially Expressed Antigen in Melanoma) is a tumor-associated antigen recognized by immunocytes, and it induces cytotoxic T cell-mediated responses in melanoma. PRAME is expressed in a wide variety of tumors, but in contrast with most other tumor-associated antigens, it
The tumour antigen PRAME is a subunit of a Cul2 ubiquitin ligase and associates with active NFY promoters.
Costessi A, et al.
The Embo Journal, 30, 3786-3786 (2011)
Matthew G Field et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 22(5), 1234-1242 (2016-03-05)
Uveal melanoma (UM) can be classified by gene expression profiling (GEP) into Class 1 (low metastatic risk) and Class 2 (high metastatic risk), the latter being strongly associated with mutational inactivation of the tumor suppressor BAP1. Nevertheless, a small percentage
Yohei Taniguchi et al.
Scientific reports, 10(1), 12286-12286 (2020-07-25)
Thymic squamous cell carcinoma (TSQCC), accounting for 70-80% of thymic carcinoma cases, is distinct from thymoma. However, differential diagnosis for type B3 thymoma is sometimes challenging, even with established markers for TSQCC, including KIT and CD5, which are expressed in ~ 80%
Array CGH analysis of chronic lymphocytic leukemia reveals frequent cryptic monoallelic and biallelic deletions of chromosome 22q11 that include the PRAME gene.
Gunn SR, et al.
Leukemia Research, 33, 1276-1281 (2009)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service