AV49932
Anti-PLXNA2 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-FLJ11751, Anti-FLJ30634, Anti-KIAA0463, Anti-OCT, Anti-PLXN2, Anti-Plexin A2
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
211 kDa
species reactivity
mouse, rat, horse, dog, guinea pig, rabbit, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PLXNA2(5362)
General description
In the fetal samples, Plexin A2 (PLXNA2) has prominent expression in fetal neural tissue.
Immunogen
Synthetic peptide directed towards the N terminal region of human PLXNA2
Application
Anti-PLXNA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
Plexin A2 (PLXNA2) is a coreceptor for semaphorins that are involved in immune responses, activation of immune cells and axon guidance during neuronal development. PLXNA2 acts as a receptor of Sema6A and has a role in limiting adult axon growth and recovery post trauma. PLXNA2 is up-regulated in metastatic prostate cancer tumors and breast cancer. Copy number variation in PLXNA2 is associated with Tetralogy of Fallot (TOF), a cyanotic congenital heart disease. Dysregulation of PLXNA2-semaphorin signaling results in congenital heart disease, characteristic of cardiac outflow tract (OFT) defect. PLXNA2 is up-regulated by osteogenic factor BMP2. Up-regulated PLXNA2 mediates osteoblast differentiation by regulation of RUNX2 (Runt-related transcription factor 2) expression.
Sequence
Synthetic peptide located within the following region: SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
T V Tian et al.
Oncogene, 33(17), 2204-2214 (2013-05-28)
Prostate cancer (PCa) is one of the major public health problems in Western countries. Recently, the TMPRSS2:ERG gene fusion, which results in the aberrant expression of the transcription factor ERG, has been shown to be the most common gene rearrangement
P N Gabrovska et al.
Gene, 489(2), 63-69 (2011-09-20)
Gene expression profiling has enabled us to demonstrate the heterogeneity of breast cancers. The potential of a tumour to grow and metastasise is partly dependant on its ability to initiate angiogenesis or growth and remodelling of new blood vessels, usually
Candice K Silversides et al.
PLoS genetics, 8(8), e1002843-e1002843 (2012-08-23)
Structural genetic changes, especially copy number variants (CNVs), represent a major source of genetic variation contributing to human disease. Tetralogy of Fallot (TOF) is the most common form of cyanotic congenital heart disease, but to date little is known about
Sang-Ohk Shim et al.
Molecular and cellular neurosciences, 50(2), 193-200 (2012-05-09)
Axonal growth from both intact and severed fibers is limited after adult mammalian CNS injury. Myelin proteins contribute to inhibition of axonal growth. Semaphorin6A protein inhibits the extension of developing axons and is highly expressed in adult oligodendrocytes. This expression
Ji-Eun Oh et al.
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, 27(3), 552-562 (2011-11-19)
The imbalance between bone-resorbing osteoclasts and bone-forming osteoblasts often leads to bone destructive diseases such as osteoporosis. In contrast to the development of several antiresorptive agents for osteoporosis therapy, discovery of anabolic drugs has been difficult because of an insufficient
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service