Skip to Content
Merck
All Photos(1)

Key Documents

WH0010891M3

Sigma-Aldrich

Anti-PGC-1α antibody produced in mouse

clone 1F3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-LEM6, Anti-PGC1, Anti-PGC1(α), Anti-PGC1A, Anti-PGC1v, Anti-PPARGC1, Anti-Peroxisome proliferative activated receptor, γ, coactivator 1, α

Sign Into View Organizational & Contract Pricing
All Photos(1)

About This Item

MDL number:
MFCD02263906
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1F3, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable

isotype

IgG2aκ

GenBank accession no.

NM_013261

UniProt accession no.

Q9UBK2

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PPARGC1A(10891)

General description

The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. (provided by RefSeq)

Immunogen

PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

Biochem/physiol Actions

Peroxisome proliferator-activated receptor γ coactivator (PGC)-1α is implicated in the modulation of the expression of mitochondrial oxidative phosphorylation (OXPHOS) genes and endogenous antioxidants. Variation in the gene expression leads to Huntington′s disease (HD) and type 2 diabetes in humans. PGC-1α functions as a ‘molecular switch′ in genetic pathways involved in maintaining glucose homeostasis in liver and muscle, β cell insulin secretion and mitochondrial biogenesis. Addition to this, PGC-1α has a crucial role to play in adaptive thermogenesis, skeletal muscle fiber type switching, and heart development. PGC-1α reduces or improves muscle dystrophy muscle dystrophy by stimulating various molecular pathways; therefore, increase in the concentration and activity of PGC-1 is considered to be a potential method for Duchenne muscular dystrophy (DMD) treatment.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rory P Cunningham et al.
Diabetes, 70(11), 2476-2491 (2021-08-13)
Regulation of endothelial nitric oxide synthase (eNOS) in hepatocytes may be an important target in nonalcoholic fatty liver disease (NAFLD) development and progression to nonalcoholic steatohepatitis (NASH). In this study, we show genetic deletion and viral knockdown of hepatocyte-specific eNOS
Christoph Handschin et al.
Genes & development, 21(7), 770-783 (2007-04-04)
The coactivator PGC-1alpha mediates key responses of skeletal muscle to motor nerve activity. We show here that neuregulin-stimulated phosphorylation of PGC-1alpha and GA-binding protein (GABP) allows recruitment of PGC-1alpha to the GABP complex and enhances transcription of a broad neuromuscular
Huiyun Liang et al.
Advances in physiology education, 30(4), 145-151 (2006-11-17)
Peroxisome proliferator-activated receptor-gamma coactivator (PGC)-1alpha is a member of a family of transcription coactivators that plays a central role in the regulation of cellular energy metabolism. It is strongly induced by cold exposure, linking this environmental stimulus to adaptive thermogenesis.
S Soyal et al.
Diabetologia, 49(7), 1477-1488 (2006-06-06)
Data derived from several recent studies implicate peroxisome proliferator-activated receptor-gamma coactivator-1alpha (PGC-1alpha) in the pathogenesis of type 2 diabetes. Lacking DNA binding activity itself, PGC-1alpha is a potent, versatile regulator of gene expression that co-ordinates the activation and repression of

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service