Skip to Content
Merck
All Photos(2)

Key Documents

HPA045212

Sigma-Aldrich

Anti-BICC1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Bicaudal C Homolog 1 (Drosophila)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL

immunogen sequence

NAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BICC1(80114)

General description

The gene BICC1 (BicC family RNA binding protein 1) is mapped to human chromosome 10q21.1. The gene encodes an RNA binding protein. In brain, BICC1 exists in many isoforms. The protein has three RNA-binding K-homology (KH) domains and a sterile α motif (SAM).

Immunogen

BicC family RNA binding protein 1

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

BICC1 (BicC family RNA binding protein 1) is involved in cytoskeletal organization and cell-to-cell communication. The protein has a sterile α motif (SAM) domain which can stop Wnt signaling, thereby influencing the pathophysiology of depression. The BICC1 gene is upregulated in the post-mortem brains of people with major depressive disorder. In rat models, BICC1 is associated with chronic stress and use of antidepressants reduces its expression. BICC1 also controls PKD2 (polycystin 2, transient receptor potential cation channel) mRNA levels and thereby works as a genetic factor for osteoblastogenesis and bone marrow density. Mutations in this gene, which result in Wnt hyperactivity, are associated with cystic renal dysplasia.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86700

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

GWAS-identified risk variants for major depressive disorder: Preliminary support for an association with late-life depressive symptoms and brain structural alterations.
Ryan J, et al.
European Neuropsychopharmacology, 26, 113-125 (2016)
BICC1 expression is elevated in depressed subjects and contributes to depressive behavior in rodents.
Ota KT, et al.
Neuropsychopharmacology, 40, 711-718 (2015)
Bicc1 is a genetic determinant of osteoblastogenesis and bone mineral density.
Mesner LD, et al.
The Journal of Clinical Investigation, 124, 2736-2749 (2014)
Two mutations in human BICC1 resulting in Wnt pathway hyperactivity associated with cystic renal dysplasia.
Kraus MR, et al.
Human Mutation, 33, 86-90 (2012)
Ruohan Sun et al.
Frontiers in genetics, 12, 768930-768930 (2021-11-05)
Purpose: Glioblastoma multiforme (GBM) is the most widely occurring brain malignancy. It is modulated by a variety of genes, and patients with GBM have a low survival ratio and an unsatisfactory treatment effect. The irregular regulation of RNA binding proteins

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service