Skip to Content
Merck
All Photos(7)

Documents

HPA039281

Sigma-Aldrich

Anti-DIS3 antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Dis3 mitotic control homolog (S. cerevisiae), Anti-Dis3p, Anti-Exosc11, Anti-Exosome complex exonuclease RRP44, Anti-Kiaa1008, Anti-Rrp44

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

EAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSN

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DIS3(22894)

Looking for similar products? Visit Product Comparison Guide

General description

The DIS3 homolog, exosome endoribonuclease and 3′-5′ exoribonuclease (DIS3) gene, with 21 exons spanning 26.5kb of genomic DNA, is mapped to human chromosome 13q21-q22. The encoded protein is a human ortholog of yeast Dis3p. DIS3 belongs to the RNase II family and is composed of 958 amino acids. DIS3 is a catalytic subunit and is localized in the nucleus and cytoplasm. DIS3 contains a RNB domain involved in the exonucleolytic activity and an N-terminal PilT N-terminal (PIN) domain involved in the endonucleolytic activity.

Immunogen

DIS3 exosome endoribonuclease and 3′-5′ exoribonuclease

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

DIS3 homolog, exosome endoribonuclease and 3′-5′ exoribonuclease (DIS3) has both active exonuclease and endonucleolytic activity. The encoded protein is involved in the direct processing, turnover and surveillance of a large number of distinct RNA species.Inactivation mutations of DIS3 is associated with relapsed acute myeloid leukemia (AML). In addition, mutation of hDIS3 PilT N terminus (PIN) domain is also associated with the development of multiple myeloma (MM). Therefore, hDIS3 PIN domain can be considered as a potential target for the treatment of MM.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST81290

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A single subunit, Dis3, is essentially responsible for yeast exosome core activity.
Dziembowski A
Nature Structural and Molecular Biology, 14, 15-22 (2007)
Identification of a novel chromosome region, 13q21.33-q22.2, for susceptibility genes in familial chronic lymphocytic leukemia.
Ng D
Blood, 109, 916-925 (2007)
The human core exosome interacts with differentially localized processive RNases: hDIS3 and hDIS3L.
Tomecki R
The Embo Journal, 29, 2342-2357 (2010)
Multiple myeloma-associated hDIS3 mutations cause perturbations in cellular RNA metabolism and suggest hDIS3 PIN domain as a potential drug target.
Tomecki R
Nucleic Acids Research, 42, 1270-1290 (2014)
A genomic map of a 6-Mb region at 13q21-q22 implicated in cancer development: identification and characterization of candidate genes.
Rozenblum E
Human Genetics, 110, 111-121 (2002)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service