Skip to Content
Merck
All Photos(1)

Key Documents

AV32443

Sigma-Aldrich

Anti-LHX3 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-LIM homeobox 3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

43 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... LHX3(8022)

General description

LHX3 is a LIM homeodomain protein that functions as a transcription factor and is required for the development of pituitary gland. It also determines the cell types that secrete anterior pituitary hormones. Mutations in LHX3 have been linked to combined pituitary hormone deficiency in humans.
Rabbit Anti-LHX3 (AB1) antibody recognizes canine, human, zebrafish, bovine, chicken, pig, and mouse LHX3.

Immunogen

Synthetic peptide directed towards the middle region of human LHX3

Application

Rabbit Anti-LHX3 (AB1) antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Biochem/physiol Actions

LHX3 is a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. Two transcripts variants encoding distinct isoforms have been identified for this gene.

Sequence

Synthetic peptide located within the following region: NMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

I Netchine et al.
Nature genetics, 25(2), 182-186 (2000-06-03)
Combined pituitary hormone deficiency (CPHD) has been linked with rare abnormalities in genes encoding transcription factors necessary for pituitary development. We have isolated LHX3, a gene involved in a new syndrome, using a candidate-gene approach developed on the basis of
K W Sloop et al.
Gene, 265(1-2), 61-69 (2001-03-20)
The Lhx3 LIM homeodomain transcription factor is critical for pituitary gland formation and specification of the anterior pituitary hormone-secreting cell types. Two mutations in LHX3, a missense mutation changing a tyrosine to a cysteine and an intragenic deletion that results

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service