Skip to Content
Merck
All Photos(3)

Key Documents

WH0008795M1

Sigma-Aldrich

Monoclonal Anti-TNFRSF10B antibody produced in mouse

clone 2D6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DR5, Anti-KILLER, Anti-KILLER/DR5, Anti-TRAILR2, Anti-TRICK2, Anti-TRICK2A, Anti-TRICK2B, Anti-TRICKB, Anti-ZTNFR9, Anti-tumor necrosis factor receptor superfamily, member 10b

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2D6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. (provided by RefSeq)

Immunogen

TNFRSF10B (AAH01281, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDC

Biochem/physiol Actions

The gene TNFRSF10B (TNF receptor superfamily member 10b) is a tumor suppressor gene, which upon mutation, leads to a loss of chromosome p arm, a common occurrence in head and neck tumors. It inhibits tumorigenesis via apoptosis. The cytoplasmic death domain (DD) of the protein employs fas-associated death domain (FADD) and caspases to form the death-inducing signal complex (DISC) when the receptor is trimerized. This leads to activation of caspases and cell death.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Tumor necrosis factor receptor superfamily 10B (TNFRSF10B): an insight from structure modeling to virtual screening for designing drug against head and neck cancer.
Tahir RA
Theoretical Biology & Medical Modelling, 10 (2013)
Parthenolide induces apoptosis via TNFRSF10B and PMAIP1 pathways in human lung cancer cells.
Zhao X
Journal of Experimental & Clinical Cancer Research, 33 (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service