Skip to Content
Merck
All Photos(5)

Key Documents

HPA004186

Sigma-Aldrich

Anti-GIT1 antibody produced in rabbit

Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ARF GTPase-activating protein GIT1 antibody produced in rabbit, Anti-Cat-1 antibody produced in rabbit, Anti-Cool-associated and tyrosine-phosphorylated protein 1 antibody produced in rabbit, Anti-G protein-coupled receptor kinase-interactor 1 antibody produced in rabbit, Anti-GRK-interacting protein 1 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing
All Photos(5)

About This Item

MDL number:
MFCD03455053
UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA004186
NACRES:
NA.43

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

DLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVSSSLSDELRRLQREIHKLQAENLQLRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSAL

UniProt accession no.

Q9Y2X7

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GIT1(28964)

Looking for similar products? Visit Product Comparison Guide

Related Categories

General description

GIT1 (G protein-coupled receptor kinase interactor 1) is an adaptor protein involved in the GTPase-activating protein activity for the ADP-ribosylating factor. It is also named as Cat-1, p95-APP1 and p95PKL.

Immunogen

ARF GTPase-activating protein GIT1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

GIT1 is involved in the regulation of cell adhesion, migration, and membrane traffic. It helps to control cellular responses through the activation of heterotrimeric G proteins. GITs possesses binding sites for various proteins such as GRKs, ARF1, Rac1, Cdc42, PAK, MEK1, PLCg1, FAK, paxillin and PAK-exchange-interacting factor (PIX). It is also involved in receptor internalization. It helps in regulating membrane trafficking between the plasma membrane and endosomes, targeting ARFs to the ARF-GAP activity of GITs. Also it has been found to play a pathogenic role in Huntington′s disease.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86813

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Antonio Totaro et al.
Molecular biology of the cell, 18(12), 5124-5138 (2007-09-28)
G-protein coupled receptor kinase-interacting protein (GIT) proteins include an N-terminal Arf GTPase-activating protein domain, and a C terminus that binds proteins regulating adhesion and motility. Given their ability to form large molecular assemblies, the GIT1 protein must be tightly regulated.
Heike Goehler et al.
Molecular cell, 15(6), 853-865 (2004-09-24)
Analysis of protein-protein interactions (PPIs) is a valuable approach for characterizing proteins of unknown function. Here, we have developed a strategy combining library and matrix yeast two-hybrid screens to generate a highly connected PPI network for Huntington's disease (HD). The
Judith Haendeler et al.
The Journal of biological chemistry, 278(50), 49936-49944 (2003-10-03)
Critical events for vasoconstrictor and growth factor signal transduction include stimulation of phospholipase Cgamma (PLCgamma) and elevation of intracellular calcium. c-Src has been proposed as a common mediator for these signals activated by both G protein-coupled receptors (GPCRs) and tyrosine
Ryan J Hoefen et al.
Journal of cell science, 119(Pt 8), 1469-1475 (2006-04-07)
The G-protein-coupled receptor (GPCR)-kinase-interacting proteins 1 and 2 (GIT1 and GIT2) are ubiquitous multidomain proteins involved in diverse cellular processes. They traffic between three distinct cellular compartments (cytoplasmic complexes, focal adhesions and the cell periphery) through interactions with proteins including
C E Turner et al.
The Journal of cell biology, 145(4), 851-863 (1999-05-20)
Paxillin is a focal adhesion adaptor protein involved in the integration of growth factor- and adhesion-mediated signal transduction pathways. Repeats of a leucine-rich sequence named paxillin LD motifs (Brown M.C., M.S. Curtis, and C.E. Turner. 1998. Nature Struct. Biol. 5:677-678)
View All Related Papers

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service