Skip to Content
Merck
All Photos(2)

Key Documents

AV47590

Sigma-Aldrich

Anti-SMC3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-BAM, Anti-BMH, Anti-CDLS3, Anti-CSPG6, Anti-HCAP, Anti-SMC3L1, Anti-Structural maintenance of chromosomes 3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

74 kDa

species reactivity

horse, bovine, rat, human, guinea pig, dog, mouse, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SMC3(9126)

General description

SMC3 codes for a part of the cohesion complex that regulates chromosome segregation during mitosis. It is known to form a heterodimer with SMC1, which subsequently can restructure the double helical form of DNA into a series of loops. Studies have reported that the opening of the Smc3-Scc1 gate is needed for removal of cohesion from chromosomes during prophase. However, in Drosophila, the disengagement of Smc3/kleisin interface releases cohesin from chromosomes during mitosis and interphase.
Rabbit Anti-SMC3 antibody recognizes human, mouse, rat, chicken, zebrafish, bovine, and canine SMC3.

Immunogen

Synthetic peptide directed towards the C terminal region of human SMC3

Application

Rabbit Anti-SMC3 antibody is suitable for western blot applications at a concentration of 0.25μg/ml. The product can also be used for IHC applications.

Biochem/physiol Actions

SMC3 belongs to the SMC3 subfamily of SMC proteins. SMC3 occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation.

Sequence

Synthetic peptide located within the following region: GKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Mingxuan Sun et al.
Nucleic acids research, 41(12), 6149-6160 (2013-04-27)
Cohesin plays a critical role in sister chromatid cohesion, double-stranded DNA break repair and regulation of gene expression. However, the mechanism of how cohesin directly interacts with DNA remains unclear. We report single-molecule experiments analyzing the interaction of the budding
Johannes Buheitel et al.
The EMBO journal, 32(5), 666-676 (2013-01-31)
Faithful transmission of chromosomes during eukaryotic cell division requires sister chromatids to be paired from their generation in S phase until their separation in M phase. Cohesion is mediated by the cohesin complex, whose Smc1, Smc3 and Scc1 subunits form
Christian S Eichinger et al.
The EMBO journal, 32(5), 656-665 (2013-01-24)
Cohesin's Smc1, Smc3, and kleisin subunits create a tripartite ring within which sister DNAs are entrapped. Evidence suggests that DNA enters through a gate created by transient dissociation of the Smc1/3 interface. Release at the onset of anaphase is triggered

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service