Skip to Content
Merck
All Photos(4)

Key Documents

WH0001390M2

Sigma-Aldrich

Monoclonal Anti-CREM antibody produced in mouse

clone 3B5, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-ICER, Anti-MGC111110, Anti-MGC17881, Anti-MGC41893, Anti-cAMP responsive element modulator, Anti-hCREM2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3B5, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CREM(1390)

General description

This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. (provided by RefSeq)
cAMP responsive element modulator (CREM) is encoded by the gene mapped to human chromosome 10p11.21. The encoded protein has tissue specific expression and it belongs to the family of cAMP-responsive promoter element (CRE)-binding factors. CREM contains 3′-located bZIP DNA-binding domains (DBD), kinase-inducible domain (KID) and two glutamine-rich domains.

Immunogen

CREM (NP_853549, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY

Biochem/physiol Actions

In mice, cAMP responsive element modulator (CREM) plays a crucial role in spermatid development. CREM is an essential constituent of cAMP-mediated signal transduction, which links extracellular signals to gene regulation. The encoded protein facilitates physiological and developmental function within the hypothalamic-pituitary-gonadal axis. Elevated expression of the gene has been observed in hepatocellular carcinoma (HCC) patients.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Inducibility and negative autoregulation of CREM: An alternative promoter directs the expression of ICER, an early response repressor
Molina CA, et al.
Cell, 75, 875-886 (1993)
Adrenergic signals direct rhythmic expression of transcriptional represser CREM in the pineal gland
Stehle JH, et al.
Nature, 365, 314-320 (1993)
CREM activator and repressor isoforms in human testis: sequence variations and inaccurate splicing during impaired spermatogenesis
Behr R and Weinbauer GF
Molecular Human Reproduction, 6, 967-972 (2000)
Specific genomic and transcriptomic aberrations in tumors induced by partial hepatectomy of a chronically inflamed murine liver
Ella E, et al.
Oncotarget, 5, 10318-10331 (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service