MSQC16
SILu™Lite SigmaMAb Adalimumab Monoclonal Antibody
recombinant, expressed in CHO cells
Synonym(s):
Mass spectrometry standard, Adalimumab
About This Item
Recommended Products
recombinant
expressed in CHO cells
Assay
≥90% (SDS-PAGE)
form
solid
suitability
suitable for mass spectrometry
shipped in
wet ice
storage temp.
−20°C
1 of 4
This Item | MSQC11 | MSQC22 | MSQC25 |
---|---|---|---|
form solid | form - | form solid | form solid |
storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells |
assay ≥90% (SDS-PAGE) | assay ≥90% (SDS-PAGE) | assay ≥90% (SDS-PAGE) | assay ≥90% (HPLC) |
suitability suitable for mass spectrometry | suitability - | suitability suitable for mass spectrometry | suitability suitable for mass spectrometry |
General description
SigmaMAb Adalimumab is for R&D use only. Not for drug, household, or other uses.
Sequence
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMab Adalimumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Legal Information
Storage Class Code
11 - Combustible Solids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Customers Also Viewed
Articles
Workflows for monoclonal antibody adalimumab characterization ensure drug safety and efficacy through critical quality attribute analysis.
Workflows for monoclonal antibody adalimumab characterization ensure drug safety and efficacy through critical quality attribute analysis.
Workflows for monoclonal antibody adalimumab characterization ensure drug safety and efficacy through critical quality attribute analysis.
Workflows for monoclonal antibody adalimumab characterization ensure drug safety and efficacy through critical quality attribute analysis.
Protocols
An optimized LC-MS/MS based workflow for low artifact tryptic digestion and peptide mapping of monoclonal antibody, adalimumab (Humira) using filter assisted sample preparation (FASP).
A step-by-step protocol for released N-linked glycan analysis of the monoclonal antibody adalimumab, based on UHPLC-FLR-MS and procainamide labeling.
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service