Skip to Content
Merck
All Photos(13)

Key Documents

AMAB90988

Sigma-Aldrich

Monoclonal Anti-PDIA3 antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL2444, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(s):

Monoclonal Anti-ERp57, Monoclonal Anti-ERp60, Monoclonal Anti-ERp61, Monoclonal Anti-GRP57, Monoclonal Anti-GRP58, Monoclonal Anti-HsT17083, Monoclonal Anti-P58, Monoclonal Anti-PI-PLC

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

CL2444, monoclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 1 μg/mL
immunofluorescence: 2-10 μg/mL
immunohistochemistry: 1:5000- 1:10000

isotype

IgG1

immunogen sequence

PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PDIA3(2923)

General description

Monoclonal Anti-PDIA3 Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and
PDIA3 (protein disulfide isomerase family A member 3) is also known as ERp57. It is present in the cytoplasm, nucleus and endoplasmic reticulum. ERp57 is a constituent of the multimeric spermatozoa-zona pellucida (ZP) receptor complex. This gene is located on human chromosome 15q15.

Immunogen

Protein disulfide isomerase family A, member 3

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Monoclonal Anti-PDIA3 antibody has been used in immunofluorescence.

Biochem/physiol Actions

PDIA3 (protein disulfide isomerase family A member 3) participates in virus induced endoplasmic reticulum stress (ERS). It plays a major role in tumorigenesis. ERp57 is involved in the generation of major histocompatibility complex class I (MHC I) to impact the immunogenicity of tumor cells. It also regulates the thiol-disulphide status of proteins. PDIA3 is linked with several diseases like, cancer, prion disorders, Alzheimer′s disease and Parkinson′s diseases.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86567

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Elena P Kolpikova et al.
Viruses, 12(3) (2020-03-07)
Zika virus (ZIKV) is an emergent member of the Flaviviridae family which causes severe congenital defects and other major sequelae, but the cellular processes that support ZIKV replication are incompletely understood. Related flaviviruses use the endoplasmic reticulum (ER) as a
The roles of protein disulphide isomerase family A, member 3 (ERp57) and surface thiol/disulphide exchange in human spermatozoa-zona pellucida binding.
Wong CW, et al.
Human Reproduction, 32(4), 733-742 (2017)
Comparative Analysis of the Interaction between Different Flavonoids and PDIA3.
Giamogante F, et al.
Oxidative Medicine and Cellular Longevity, 2016, 4518281-4518281 (2016)
Salinomycin kills cancer stem cells by sequestering iron in lysosomes.
Mai TT, et al.
Nature Chemistry, 9, 1025?1033-1025?1033 (2017)
Increased ERp57 Expression in HBV-Related Hepatocellular Carcinoma: Possible Correlation and Prognosis.
Miao L, et al.
BioMed Research International, 2017, 1252647-1252647 (2017)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service