추천 제품
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
4H4, monoclonal
형태
buffered aqueous solution
종 반응성
human
기술
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG1κ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... RHOT1(55288)
일반 설명
Ras homolog family member T1 (RHOT1) is encoded by the gene mapped to human chromosome 17q11.2. RhoT1 is a member of mitochondrial Rho GTPase family.
면역원
RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP
Sequence
TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP
생화학적/생리학적 작용
Ras homolog family member T1 (RHOT1) plays an essential role in controlling mitochondrial homeostasis and apoptosis. RHOT1 serves as a tumor suppressor gene for pancreatic cancer (PC), and it can be considered as a potential prognostic biomarker for overall survival and as a promising therapeutic target for PC. Decreased expression of RHOT1 might result in lymph node metastasis (LNM) and shorter survival. RHOT1 has a crucial role to play in mitochondrial transport, lymphocyte migration, and polarity.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
nwg
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
이미 열람한 고객
Pei-I Tsai et al.
Molecular biology of the cell, 28(24), 3471-3479 (2017-09-15)
MIC60/mitofilin constitutes a hetero-oligomeric complex on the inner mitochondrial membranes to maintain crista structure. However, little is known about its physiological functions. Here, by characterizing
Renu Bajaj et al.
Molecular cytogenetics, 4, 3-3 (2011-01-22)
To evaluate the clinical validity of genome-wide oligonucleotide array comparative genomic hybridization (aCGH) for detecting somatic abnormalities, we have applied this genomic analysis to 30 cases (13 MDS and 17 AML) with clonal chromosomal abnormalities detected in more than 50%
Jinshan Qin et al.
Nature communications, 11(1), 4471-4471 (2020-09-10)
A human cell contains hundreds to thousands of mitochondrial DNA (mtDNA) packaged into nucleoids. Currently, the segregation and allocation of nucleoids are thought to be passively determined by mitochondrial fusion and division. Here we provide evidence, using live-cell super-resolution imaging
Annekathrin Moller et al.
Human molecular genetics, 26(23), 4668-4679 (2017-10-04)
Defective axonal transport is an early neuropathological feature of amyotrophic lateral sclerosis (ALS). We have previously shown that ALS-associated mutations in Cu/Zn superoxide dismutase 1 (SOD1) impair axonal transport of mitochondria in motor neurons isolated from SOD1 G93A transgenic mice
RhoT1 and Smad4 are correlated with lymph node metastasis and overall survival in pancreatic cancer.
Hua Jiang et al.
PloS one, 7(7), e42234-e42234 (2012-08-04)
Cancer cell invasion and metastasis are the most important adverse prognostic factors for pancreatic cancer. Identification of biomarkers associated with outcome of pancreatic cancer may provide new approaches and targets for anticancer therapy. The aim of this study is to
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.