추천 제품
![(RP)-1-[(R)-α-(Dimethylamino)-2-(diphenylphosphino)benzyl]-2-diphenylphosphinoferrocene optical purity ee: ≥99%](/deepweb/assets/sigmaaldrich/product/structures/361/819/e2566437-d2aa-4d81-8926-06a3497f90ce/640/e2566437-d2aa-4d81-8926-06a3497f90ce.png)
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
2C1-2F2, monoclonal
형태
buffered aqueous solution
종 반응성
human
기술
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2bκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... THAP1(55145)
일반 설명
THAP domain containing 1 (THAP1) is a transcription factor encoded by the gene mapped to human chromosome 18p11.21. The encoded protein contains an N-terminal conserved DNA-binding domain, designated THAP domain with a zinc-finger structure.
면역원
THAP1 (AAH21721, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA
Sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA
생화학적/생리학적 작용
THAP domain containing 1 (THAP1) plays a key role in endothelial cell proliferation and pro-apoptotic processes. Mutation in the gene is associated with primary dystonia type 6 (DYT6). The encoded protein links prostate-apoptosis-response-4 (Par-4) to promyelocytic leukemia (PML) nuclear bodies, which facilitates both serum withdrawal and tumor necrosis factor-α (TNF-α)-induced apoptosis.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
nwg
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Intrafamilial variability of the primary dystonia DYT6 phenotype caused by p.Cys5Trp mutation in THAP1 gene.
Jurek M, et.al
Neurologia i Neurochirurgia Polska, 48(4), 254-257 (2014)
Interaction between variants of two glycosyltransferase genes in IgA nephropathy.
Zhu L, et.al
Kidney International, 76(2), 190-198 (2009)
Screening for THAP1 Mutations in Polish Patients with Dystonia Shows Known and Novel Substitutions.
Golanska E
PLoS ONE, 10(6), e0129656-e0129656 (2015)
Li Zhu et al.
Kidney international, 76(2), 190-198 (2009-04-10)
Increasing evidence points to the importance of aberrant O-glycosylated immunoglobulin A1 (IgA1) in the pathogenesis of IgA nephropathy (IgAN), a disease widely considered to be a polygenic disorder. We earlier found that haplotypes in two key glycosyltransferase genes, C1GALT1 and
Marta Jurek et al.
Neurologia i neurochirurgia polska, 48(4), 254-257 (2014-08-30)
Mutations localized in THAP1 gene, locus 18p11.21 have been reported as causative of primary dystonia type 6 (DYT6). Disease which is characterized mainly by focal dystonia, frequently involving the craniocervical region, however associated also with early-onset generalized dystonia and spasmodic
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.