WH0027158M1

Monoclonal Anti-NDOR1 antibody produced in mouse

clone 3A11, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-MGC138148, Anti-NADPH dependent diflavin oxidoreductase 1, Anti-NR1, Anti-bA350O14.9
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3A11, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: mouse, human, rat
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: NM_014434
• UniProt 수납 번호: Q9UHB4
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... NDOR1(27158)

설명

일반 설명

This gene encodes an NADPH-dependent diflavin reductase that contains both flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) binding domains. The encoded protein is an enzyme that catalyzes the transfers electrons from NADPH through FAD and FMN cofactors to potential redox partners. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

면역원

NDOR1 (NP_055249, 498 a.a. ~ 595 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTET

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)