WH0025824M1

Monoclonal Anti-PRDX5 antibody produced in mouse

clone 3E6, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-ACR1, Anti-AOEB166, Anti-B166, Anti-MGC117264, Anti-PLP, Anti-PMP20, Anti-PRDX6, Anti-PRXV, Anti-SBBI10, Anti-peroxiredoxin 5
• MDL number: MFCD01322366
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3E6, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgG2aκ
• GenBank 수납 번호: NM_012094
• UniProt 수납 번호: P30044
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PRDX5(25824)

설명

일반 설명

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)

면역원

PRDX5 (NP_036226, 105 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)