WH0011074M3

Monoclonal Anti-TRIM31 antibody produced in mouse

clone 2G11, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-C6orf13, Anti-HCG1, Anti-HCGI, Anti-RNF, Anti-tripartite motif-containing 31
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2G11, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: immunofluorescence: suitable; indirect ELISA: suitable
• 동형: IgG2aκ
• GenBank 수납 번호: NM_007028
• UniProt 수납 번호: Q9BZY9
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TRIM31(11074)

설명

일반 설명

TRIM31 (tripartite motif-containing 31) belongs to TRIM (tripartite motif-containing protein) family. It is particularly expressed in the gastrointestinal tract. TRIM31 contains carboxy-terminal PRY and SPRY (spla kinase and ryanodine receptor) domains. It is usually located in the cytoplasm, but a fraction of TRIM31 is present in the mitochondria. TRIM31 is located on human chromosome 6p22.1.

면역원

TRIM31 (NP_008959, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQE

생화학적/생리학적 작용

Overexpression of TRIM31 (tripartite motif-containing 31) suppresses anchorage-independent cell growth generated by the active form of c-Src. It is expected to play a major role in gastrointestinal tissue-specific regulation of cell proliferation.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)